Tupaia chinensis (Chinese tree shrew): 102480187 Help Entry 102480187         CDS       T02978                                  Symbol MAX Name (RefSeq) MYC associated factor X   KO K04453   Max protein Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03083   Polycomb repressive complex tup04010   MAPK signaling pathway tup05200   Pathways in cancer tup05202   Transcriptional misregulation in cancer tup05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     102480187 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102480187 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102480187 (MAX)    05202 Transcriptional misregulation in cancer     102480187 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     102480187 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tup03000]     102480187 (MAX)    03036 Chromosome and associated proteins [BR:tup03036]     102480187 (MAX) Transcription factors [BR:tup03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     102480187 (MAX) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      102480187 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH Filament bZIP_2 JetA SlyX Jnk-SapK_ap_N DUF5595 GAGA_bind SLX9 DUF4763 Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  102480187 NCBI-ProteinID:  XP_006142473 LinkDB All DBs Position Un AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagaatatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcaacaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcagactcc agctcggagtcggagcccgaagagccccagagcaggaagaaactccgcatggaggccagc taa

DBGET integrated database retrieval system