KEGG   Trichophyton verrucosum: TRV_00376Help
Entry
TRV_00376         CDS       T01615                                 

Definition
(RefSeq) cytochrome P450 monooxygenase, putative
  KO
K21292  ent-kaurene oxidase [EC:1.14.14.86]
Organism
tve  Trichophyton verrucosum
Pathway
tve00904  Diterpenoid biosynthesis
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    TRV_00376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tve00199]
    TRV_00376
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     TRV_00376
Cytochrome P450 [BR:tve00199]
 Cytochrome P450, fungi type
  CYP503 family
   TRV_00376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 9581692
NCBI-ProteinID: XP_003025436
UniProt: D4CZY2
LinkDB All DBs
AA seq 689 aa AA seqDB search
METTNVSSGLLGPVYTALPEIEWNGRQGFALFIVAILSLHLFNVFKESLFGVKAPMVGYR
SFFEPKWLLRLRFVRGSMSIIRGGYSKYKDSMFKISRNDADILVISNKYVDELRNLPEEE
LSGIEAHIRNLLGSISTTHVMLETNLHTRVLQTKLTPALGLIFDDMKDELNFALETELPE
CKDKWVPISINHLMLRLLARVSARIFVGRANCRNEEWLSASIDYTENIFITVMTLRMMPR
YLHPFVAPLLPWYWRIRSNLATAKRFIGPIIRERREAEARQGKDYQKHEDLLQWMMDGAN
EKESNPDMIAHIELLLTLASIHTSSMATSNVMYDLCAHPEYFEPLREEMLSARREDGGWR
KTTLTKLRKLDSFLKESQRMNPPSQLAFNRVVRSTLKLSDGTVLPAGTHFNIASDAIMND
PAKLPGGGDPEVFDGFRYERLRSDPAHPENANRFQLAMTDSNNLHFGHGKYACPGRFFAS
NEIKMIITELLLRYDFKYPEGQERPRSLSADENLYPDPDARVLIRRREESVLLLAGVTVN
PTILSLNKLQDCIWLARYIYNYMTSGFRREYYVINDNCRNQNEETVVVKSVGHFGIHNEQ
DIFLHFQDKTNVLRPLLDEIKDSSAPHSIILRYLDDDILHAADWATMQLISLLYGEGFHI
FRPDVPVDHDDYSVKILMKHHRCFGPFPV
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaccaacgttagcagcgggctgcttggcccggtctatactgctctgccagag
atcgagtggaacggccgtcagggcttcgctctcttcatcgtcgcgattttatctctgcat
ctcttcaatgtcttcaaggaaagcctctttggcgtcaaggcgcccatggtcggctataga
tctttcttcgagcccaaatggcttttacgtctgcgatttgtgcgaggcagcatgtctatc
atccgcggcggttatagcaagtacaaagactccatgttcaagataagccgcaatgatgca
gacatcctcgttatctcgaacaagtacgtggacgagcttcggaatttgccagaggaagag
ctcagcggcatcgaggcacatatcaggaacctcctgggcagcatttcgactacgcatgtc
atgcttgagaccaacctgcatacccgcgtgctccagacaaagctgaccccagctctgggt
ctgatatttgacgacatgaaagatgagctcaattttgctctggagaccgagttaccagaa
tgtaaagataaatgggttcccatatccatcaaccatcttatgttacggctcctcgctcgg
gtttcggctcgcatattcgtcggtagggccaactgtcgcaacgaggagtggctctcagcc
agcatcgactatacagagaacatattcatcacagtcatgactctgcgaatgatgccgcgc
tatctccatccatttgttgccccccttttgccctggtactggcgtatacgctccaatctg
gccaccgcaaaacgctttatcggtcccatcatacgcgagcgtagggaggccgaggcccgg
caagggaaggactaccagaagcatgaggacctcctccagtggatgatggatggggcaaac
gaaaaggaaagcaatccggatatgatagcccatatcgaacttctccttacgctggcctca
atccatacctcttcgatggccacgtcaaatgtgatgtacgatctttgtgctcacccagag
tactttgaaccccttcgagaggaaatgctctctgcacggcgcgaagacggcggatggcga
aagactactttgacgaagctaagaaaacttgatagcttccttaaggagtctcaacgaatg
aatcccccaagccaattggcattcaaccgcgttgtccggtcgaccctcaaactatcagat
ggcacagtcctgcctgctggtacacatttcaacatagcctctgacgctatcatgaacgat
cccgccaaactccccggtggcggcgacccggaagtcttcgatgggttccgctacgagcgg
ctccgtagcgatccggcccatcccgaaaatgctaatcggttccagctggccatgacagac
agcaataatctacatttcggacacgggaagtatgcatgcccggggcggtttttcgccagc
aatgaaatcaagatgatcatcactgagctgctgttgcgttacgactttaagtatccggag
ggacaggagaggccgcgcagcctgagtgcggatgagaatttgtatcctgatccggatgct
agggtgttgatacggagacgagaagaatctgttctgctgctagctggtgtcactgtgaat
cccaccattctttcactaaacaaactgcaagactgcatttggcttgcaaggtatatatat
aactacatgacctctggattccgccgggagtactatgttattaatgacaattgcagaaac
cagaacgaggagacagtagtggtgaagagtgtcggccactttggaatccacaacgaacag
gatatttttcttcatttccaagacaaaacaaatgtacttcgtccgctgcttgatgagatc
aaagactcctcggcacctcattctatcatattaagatacctggacgatgacattctgcac
gctgctgactgggctacaatgcagctcatcagcctgctatatggggaagggttccacatc
tttagacccgatgtcccagtagaccatgatgattacagcgtcaagattctcatgaagcat
caccggtgcttcggcccattcccggtatga

DBGET integrated database retrieval system