Ursus arctos (brown bear): 113243711 Help Entry 113243711         CDS       T05909                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism uah  Ursus arctos (brown bear) Pathway uah01523   Antifolate resistance uah04010   MAPK signaling pathway uah04060   Cytokine-cytokine receptor interaction uah04061   Viral protein interaction with cytokine and cytokine receptor uah04064   NF-kappa B signaling pathway uah04071   Sphingolipid signaling pathway uah04150   mTOR signaling pathway uah04210   Apoptosis uah04217   Necroptosis uah04350   TGF-beta signaling pathway uah04380   Osteoclast differentiation uah04612   Antigen processing and presentation uah04620   Toll-like receptor signaling pathway uah04621   NOD-like receptor signaling pathway uah04622   RIG-I-like receptor signaling pathway uah04625   C-type lectin receptor signaling pathway uah04640   Hematopoietic cell lineage uah04650   Natural killer cell mediated cytotoxicity uah04657   IL-17 signaling pathway uah04660   T cell receptor signaling pathway uah04664   Fc epsilon RI signaling pathway uah04668   TNF signaling pathway uah04920   Adipocytokine signaling pathway uah04930   Type II diabetes mellitus uah04931   Insulin resistance uah04932   Non-alcoholic fatty liver disease uah04933   AGE-RAGE signaling pathway in diabetic complications uah04936   Alcoholic liver disease uah04940   Type I diabetes mellitus uah05010   Alzheimer disease uah05014   Amyotrophic lateral sclerosis uah05020   Prion disease uah05022   Pathways of neurodegeneration - multiple diseases uah05132   Salmonella infection uah05133   Pertussis uah05134   Legionellosis uah05135   Yersinia infection uah05140   Leishmaniasis uah05142   Chagas disease uah05143   African trypanosomiasis uah05144   Malaria uah05145   Toxoplasmosis uah05146   Amoebiasis uah05152   Tuberculosis uah05160   Hepatitis C uah05161   Hepatitis B uah05163   Human cytomegalovirus infection uah05164   Influenza A uah05165   Human papillomavirus infection uah05166   Human T-cell leukemia virus 1 infection uah05168   Herpes simplex virus 1 infection uah05169   Epstein-Barr virus infection uah05170   Human immunodeficiency virus 1 infection uah05171   Coronavirus disease - COVID-19 uah05205   Proteoglycans in cancer uah05310   Asthma uah05321   Inflammatory bowel disease uah05322   Systemic lupus erythematosus uah05323   Rheumatoid arthritis uah05330   Allograft rejection uah05332   Graft-versus-host disease uah05410   Hypertrophic cardiomyopathy uah05414   Dilated cardiomyopathy uah05417   Lipid and atherosclerosis uah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113243711 (TNF)    04350 TGF-beta signaling pathway     113243711 (TNF)    04064 NF-kappa B signaling pathway     113243711 (TNF)    04668 TNF signaling pathway     113243711 (TNF)    04071 Sphingolipid signaling pathway     113243711 (TNF)    04150 mTOR signaling pathway     113243711 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113243711 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     113243711 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     113243711 (TNF)    04217 Necroptosis     113243711 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     113243711 (TNF)    04620 Toll-like receptor signaling pathway     113243711 (TNF)    04621 NOD-like receptor signaling pathway     113243711 (TNF)    04622 RIG-I-like receptor signaling pathway     113243711 (TNF)    04625 C-type lectin receptor signaling pathway     113243711 (TNF)    04650 Natural killer cell mediated cytotoxicity     113243711 (TNF)    04612 Antigen processing and presentation     113243711 (TNF)    04660 T cell receptor signaling pathway     113243711 (TNF)    04657 IL-17 signaling pathway     113243711 (TNF)    04664 Fc epsilon RI signaling pathway     113243711 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     113243711 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     113243711 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     113243711 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     113243711 (TNF)    05170 Human immunodeficiency virus 1 infection     113243711 (TNF)    05161 Hepatitis B     113243711 (TNF)    05160 Hepatitis C     113243711 (TNF)    05171 Coronavirus disease - COVID-19     113243711 (TNF)    05164 Influenza A     113243711 (TNF)    05168 Herpes simplex virus 1 infection     113243711 (TNF)    05163 Human cytomegalovirus infection     113243711 (TNF)    05169 Epstein-Barr virus infection     113243711 (TNF)    05165 Human papillomavirus infection     113243711 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     113243711 (TNF)    05135 Yersinia infection     113243711 (TNF)    05133 Pertussis     113243711 (TNF)    05134 Legionellosis     113243711 (TNF)    05152 Tuberculosis     113243711 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     113243711 (TNF)    05144 Malaria     113243711 (TNF)    05145 Toxoplasmosis     113243711 (TNF)    05140 Leishmaniasis     113243711 (TNF)    05142 Chagas disease     113243711 (TNF)    05143 African trypanosomiasis     113243711 (TNF)   09163 Immune disease    05310 Asthma     113243711 (TNF)    05322 Systemic lupus erythematosus     113243711 (TNF)    05323 Rheumatoid arthritis     113243711 (TNF)    05321 Inflammatory bowel disease     113243711 (TNF)    05330 Allograft rejection     113243711 (TNF)    05332 Graft-versus-host disease     113243711 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     113243711 (TNF)    05014 Amyotrophic lateral sclerosis     113243711 (TNF)    05020 Prion disease     113243711 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     113243711 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113243711 (TNF)    05418 Fluid shear stress and atherosclerosis     113243711 (TNF)    05410 Hypertrophic cardiomyopathy     113243711 (TNF)    05414 Dilated cardiomyopathy     113243711 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     113243711 (TNF)    04940 Type I diabetes mellitus     113243711 (TNF)    04936 Alcoholic liver disease     113243711 (TNF)    04932 Non-alcoholic fatty liver disease     113243711 (TNF)    04931 Insulin resistance     113243711 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     113243711 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     113243711 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113243711 (TNF)    00536 Glycosaminoglycan binding proteins [BR:uah00536]     113243711 (TNF) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Tumor necrosis fators    113243711 (TNF) Glycosaminoglycan binding proteins [BR:uah00536]  Heparan sulfate / Heparin   Cytokines    113243711 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  113243711 NCBI-ProteinID:  XP_026338266 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQR EELPDGLQLINPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT DNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE TPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacgctcttctgcctgctgcacttccgcgtgatcggcccccagagg gaagagctcccagatggactccaactaatcaaccctctggcccagacagtcaaatcatct tctcgaactccaagtgacaagcctgtagctcatgttgtagcaaaccccgaagctgagggg caactccagtggctgagccggcgtgccaatgccctcctggccaatggtgtggagctgaca gacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctcttc aagggccaaggatgcccttccacccatgtgctcctcacccacaccatcagccgcttcgct gtctcttaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagggag accccagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtcttc caactggagaagggtgatcgactcagcgctgagatcaacctgcctgactacctcgacttt gccgagtctgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system