KEGG   Ursus arctos horribilis: 113243711
Entry
113243711         CDS       T05909                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
uah  Ursus arctos horribilis
Pathway
uah01523  Antifolate resistance
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04064  NF-kappa B signaling pathway
uah04071  Sphingolipid signaling pathway
uah04150  mTOR signaling pathway
uah04210  Apoptosis
uah04217  Necroptosis
uah04350  TGF-beta signaling pathway
uah04380  Osteoclast differentiation
uah04612  Antigen processing and presentation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04640  Hematopoietic cell lineage
uah04650  Natural killer cell mediated cytotoxicity
uah04657  IL-17 signaling pathway
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04920  Adipocytokine signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04940  Type I diabetes mellitus
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05310  Asthma
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05410  Hypertrophic cardiomyopathy (HCM)
uah05414  Dilated cardiomyopathy (DCM)
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113243711 (TNF)
   04350 TGF-beta signaling pathway
    113243711 (TNF)
   04064 NF-kappa B signaling pathway
    113243711 (TNF)
   04668 TNF signaling pathway
    113243711 (TNF)
   04071 Sphingolipid signaling pathway
    113243711 (TNF)
   04150 mTOR signaling pathway
    113243711 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243711 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113243711 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113243711 (TNF)
   04217 Necroptosis
    113243711 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243711 (TNF)
   04620 Toll-like receptor signaling pathway
    113243711 (TNF)
   04621 NOD-like receptor signaling pathway
    113243711 (TNF)
   04622 RIG-I-like receptor signaling pathway
    113243711 (TNF)
   04625 C-type lectin receptor signaling pathway
    113243711 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    113243711 (TNF)
   04612 Antigen processing and presentation
    113243711 (TNF)
   04660 T cell receptor signaling pathway
    113243711 (TNF)
   04657 IL-17 signaling pathway
    113243711 (TNF)
   04664 Fc epsilon RI signaling pathway
    113243711 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113243711 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113243711 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113243711 (TNF)
  09163 Immune disease
   05310 Asthma
    113243711 (TNF)
   05322 Systemic lupus erythematosus
    113243711 (TNF)
   05323 Rheumatoid arthritis
    113243711 (TNF)
   05321 Inflammatory bowel disease (IBD)
    113243711 (TNF)
   05330 Allograft rejection
    113243711 (TNF)
   05332 Graft-versus-host disease
    113243711 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113243711 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    113243711 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113243711 (TNF)
   05410 Hypertrophic cardiomyopathy (HCM)
    113243711 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    113243711 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113243711 (TNF)
   04940 Type I diabetes mellitus
    113243711 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113243711 (TNF)
   04931 Insulin resistance
    113243711 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243711 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113243711 (TNF)
   05135 Yersinia infection
    113243711 (TNF)
   05133 Pertussis
    113243711 (TNF)
   05134 Legionellosis
    113243711 (TNF)
   05152 Tuberculosis
    113243711 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243711 (TNF)
   05170 Human immunodeficiency virus 1 infection
    113243711 (TNF)
   05164 Influenza A
    113243711 (TNF)
   05161 Hepatitis B
    113243711 (TNF)
   05160 Hepatitis C
    113243711 (TNF)
   05168 Herpes simplex virus 1 infection
    113243711 (TNF)
   05163 Human cytomegalovirus infection
    113243711 (TNF)
   05169 Epstein-Barr virus infection
    113243711 (TNF)
   05165 Human papillomavirus infection
    113243711 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113243711 (TNF)
   05144 Malaria
    113243711 (TNF)
   05145 Toxoplasmosis
    113243711 (TNF)
   05140 Leishmaniasis
    113243711 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    113243711 (TNF)
   05143 African trypanosomiasis
    113243711 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    113243711 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243711 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243711 (TNF)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Tumor necrosis fators
   113243711 (TNF)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113243711 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 113243711
NCBI-ProteinID: XP_026338266
UniProt: A0A3Q7TQ93
LinkDB
Position
Unknown
AA seq 233 aa
MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EELPDGLQLINPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT
DNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE
TPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag
gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc
gtcgcaggagccaccacgctcttttgcctgctgcacttcggcgtgatcggcccccagagg
gaagagctcccagatggactccaactaatcaaccctctggcccagacagtcaaatcatct
tctcgaactccaagtgacaagcctgtagctcatgttgtagcaaaccccgaagctgagggg
caactccagtggctgagccggcgtgccaatgccctcctggccaatggtgtggagctgaca
gacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctcttc
aagggccaaggatgcccttccacccatgtgctcctcacccacaccatcagccgcttcgct
gtctcttaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagggag
accccagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtcttc
caactggagaagggtgatcgactcagcgctgagatcaacctgcctgactacctcgacttt
gccgagtctgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system