KEGG   Ursus arctos horribilis: 113245610
Entry
113245610         CDS       T05909                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245610 (IL2RG)
   04151 PI3K-Akt signaling pathway
    113245610 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245610 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113245610 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113245610 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113245610 (IL2RG)
   04659 Th17 cell differentiation
    113245610 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113245610 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113245610 (IL2RG)
   05340 Primary immunodeficiency
    113245610 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113245610 (IL2RG)
   05162 Measles
    113245610 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113245610 (IL2RG)
   04090 CD molecules [BR:uah04090]
    113245610 (IL2RG)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113245610 (IL2RG)
CD molecules [BR:uah04090]
 Proteins
  113245610 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 113245610
NCBI-ProteinID: XP_026341554
UniProt: A0A3Q7VF95
LinkDB
Position
Unknown
AA seq 383 aa
MLKPPLPLRSLLFLQLPLLGVGLNSTVPMPNGNEDVTAGGKRGTEGVDFFLTATPPGTLS
VSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPINLTLNYWYKNSKDDKVQECGHYLFSGET
TAGCWLQKEEIHLYETFVVQLQDPQEPRRQSIQMLKLQNLVIPWAPENLTLRNLSESQLE
LSWSNRHLDHCLEHLVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPLC
GSAQRWSEWSHPIHWGSNTSKENPLLFASEAVLIPLGSMGLIICLICVYYWLERVMPRIP
TLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPC
SQHSPYWAPPCYTLKPETGALIP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaactcgacggtccccatgcccaatgggaatgaagacgtcacagctggtggg
aaacgtgggactgaaggggttgatttcttcctgaccgctacaccccctgggaccctcagc
gtttctaccctgcccctcccagaggtccagtgttttgtgttcaatgttgagtacatgaat
tgcacttggaacagcagctctgagccccagcccatcaacctgactctgaactactggtac
aagaactccaaggatgataaagtccaggagtgtggccactatctattttctggagagacc
actgctggctgttggctgcaaaaggaggagatccatctctacgaaacatttgttgtccag
ctccaggacccacaggaacccaggaggcagtccatacagatgctaaaactgcagaatctg
gtgatcccctgggctccggagaacctaacccttcgcaacctgagcgaatcccagctagaa
ctgagctggagcaacagacacttggaccactgtttggagcacctcgtgcagtaccggagt
gactgggaccgcagctggactgaacaatccgtggaccaccgaaatagcttttctctgcct
agcgtggatgggcagaaattctacacgttccgtgtccggagccgctataacccactctgt
ggaagcgctcagcgttggagtgaatggagccaccccatccactggggcagcaatacttcc
aaggagaatcctttgttgtttgcatcggaagctgtgcttatcccccttggctccatggga
ttgattatttgccttatctgtgtgtactactggctggaacgggtgatgccccgaattcct
accctcaagaacctagaggatctggttactgaataccacgggaacttttcggcctggagt
ggagtgtctaagggactggcggagagtctgcagccagactacagtgaatggctctgccac
gtcagtgagattcccccaaaaggaggggctccaggggaggggcctgggggctccccctgc
agccagcatagcccctactgggctcccccatgttacaccctgaaacctgaaactggagcc
ctgataccctga

DBGET integrated database retrieval system