KEGG   Ursus arctos horribilis: 113257962
Entry
113257962         CDS       T05909                                 

Gene name
CD4
Definition
(RefSeq) T-cell surface glycoprotein CD4 isoform X1
  KO
K06454  T-cell surface glycoprotein CD4
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah05135  Yersinia infection
uah05166  Human T-cell leukemia virus 1 infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113257962 (CD4)
   04514 Cell adhesion molecules (CAMs)
    113257962 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113257962 (CD4)
   04612 Antigen processing and presentation
    113257962 (CD4)
   04660 T cell receptor signaling pathway
    113257962 (CD4)
   04658 Th1 and Th2 cell differentiation
    113257962 (CD4)
   04659 Th17 cell differentiation
    113257962 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113257962 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    113257962 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113257962 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113257962 (CD4)
   05170 Human immunodeficiency virus 1 infection
    113257962 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113257962 (CD4)
CD molecules [BR:uah04090]
 Proteins
  113257962 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set Ig_3 ig V-set Ig_2 I-set Tcell_CD4_C Ig_5 Pilin Ig_6 Herpes_gE
Other DBs
NCBI-GeneID: 113257962
NCBI-ProteinID: XP_026358355
UniProt: A0A3Q7W019
LinkDB
Position
Unknown
AA seq 461 aa
MSRGAAFRHLLLVLQLAMLPMVTLGREVVLGKAGDTAELPCHGSSGKNKGFSWKHSSMLK
ILEYGHVFPVKGASRLKPRVETKKNLWDQGSYPLIIKDLEAADSGVYFCEVAGKTQEVEL
LVFNVTAKWDTGSSSSSNIRLLQGQPLTLTVEGPSGSSPSVQWKGPGNKSKGSGQSLSLS
GLELQDSGTWTCTISQNQETVVFHINILVLAFQKVSNTVYTKEGDQVEFSFPLSFEDENL
SGELRWQAEGAPSSLLWSSFVLENRKLSVKELHVPKLQLKESLPLSFVLSQASSRYAGSG
TLTLSLAKGTLQREVNLVVMRVTKSKNNLTCEVLGPTSPELTLSLNLEERAAKVSKQQKL
VLVMDPERGTWQCLLSHKDKVLLASKIEVLPPVFTKASPKLLAIVLGGILGLLLFAGLCI
FCCVKCWHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTNLI
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagtcgaggagctgcttttaggcacctactcctggtgctgcagctggcaatgctcccc
atggtcactctgggaagagaagtcgtgctggggaaggcgggagacacagcggagctgccc
tgccacggttcctcggggaagaacaaaggcttcagctggaaacattcttccatgctcaag
attctggagtacgggcacgtcttcccggttaaaggtgcctccaggctgaagcctcgcgtc
gaaacgaaaaaaaacctgtgggaccaaggatcctatcctctgatcatcaaggatcttgaa
gcagcagactcaggggtttacttctgtgaggtagcaggcaagacgcaagaggtggagttg
ctggtgttcaacgtgactgccaagtgggacaccggcagcagcagcagcagcaacatccgc
ctgctgcaagggcagccgctgaccctgaccgtcgagggcccgtctggtagcagcccttct
gtgcaatggaaaggtccagggaataaaagcaagggcagtggccaaagcctctcactgtcc
gggctggagctgcaggacagtggtacctggacatgcaccatctcccagaaccaggagacg
gtggtgttccacataaacatcttggtgctggctttccagaaggtctctaacacagtctat
acaaaagaaggggatcaggtggagttctccttcccgcttagcttcgaggatgaaaacctg
agcggggagctgaggtggcaggcagagggggctccctcctccctgctctggagctccttc
gtcttggagaacaggaagctgtctgtgaaagagctccacgtccccaaactccagctgaag
gaatcgctcccactcagctttgtcctgtcccaggcttcgtctcggtatgctggctctgga
accctcactctgagtcttgccaaggggacactgcagcgggaagtgaatctcgtggtgatg
agagtgactaagtctaagaacaatttgacctgcgaggtgctgggacccacctcccctgag
ctgacgctgagcttgaatctggaggagcgggctgccaaggtctcgaagcagcagaagctg
gtattggtgatggaccctgagaggggcacatggcagtgtctactgagtcacaaggacaaa
gtcctgctggcatccaagatcgaggttttgcccccagtgttcaccaaggcctcgccaaag
ctcttagcgattgtgctgggcgggatcttaggccttctgcttttcgcggggctctgcatc
ttctgctgtgttaagtgctggcaccgcaggcgccaggcagagcggatgtcccagatcaag
agactcctcagtgagaagaagacctgccagtgccctcaccggttccagaagacaaatctc
atttga

DBGET integrated database retrieval system