KEGG   Ursus arctos horribilis: 113265384
Entry
113265384         CDS       T05909                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
uah  Ursus arctos horribilis
Pathway
uah01524  Platinum drug resistance
uah03440  Homologous recombination
uah03460  Fanconi anemia pathway
uah04120  Ubiquitin mediated proteolysis
uah04151  PI3K-Akt signaling pathway
uah05206  MicroRNAs in cancer
uah05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113265384 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    113265384 (BRCA1)
   03460 Fanconi anemia pathway
    113265384 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113265384 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113265384 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    113265384 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113265384 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113265384 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:uah04121]
    113265384 (BRCA1)
   03036 Chromosome and associated proteins [BR:uah03036]
    113265384 (BRCA1)
   03400 DNA repair and recombination proteins [BR:uah03400]
    113265384 (BRCA1)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113265384 (BRCA1)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113265384 (BRCA1)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113265384 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    113265384 (BRCA1)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     113265384 (BRCA1)
DNA repair and recombination proteins [BR:uah03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     113265384 (BRCA1)
    BRCA1-B complex
     113265384 (BRCA1)
    BRCA1-C complex
     113265384 (BRCA1)
    BRCA complex
     113265384 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     113265384 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse zf-RING_6 zf-ANAPC11 BRCT_2 Prok-RING_4 zf-rbx1 zf-RING_10 Baculo_IE-1
Other DBs
NCBI-GeneID: 113265384
NCBI-ProteinID: XP_026368517
UniProt: A0A3Q7XYG5
LinkDB
Position
Unknown
AA seq 1863 aa
MDLPADRVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQRKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFSKKENNSPDHLKE
EVSIIQSMGYRNRAKRLRQSEPENPALQETSLSVHLSDLGIVRSLRTKQQIQPQNKSVYI
ELGSDSSEDTVNKASYCSVGDDELLQITPQGARAEASLNPAKKAACEISEDITNIEHHQS
GNKDLTTTEKHATEKHPEKYQGISVSNLHVEPCGTNTHTSSLQHENSSLLLTKDRMNVEK
AEFCNKSKQLGSARSQQSRWAGSKETCNDRQTPSTEKKVLLNADPLHGRKEPRKQKPACS
DSPRDSQDVPWITLNSSVQKVNEWFSRSDGMLPSDDSHDGGSDSNTGVAGAVEVPNEVDG
YSGSSEKVDLMASDPQVALIRGSERVHPKSVESNIEDKIFGKTYRRRASLPSHTNEDLII
GFRAIEPQTTRAHPLTNKAKCKRRTTSGLLPEDFIKKVDLAVVPKTPEKLVEGTNQIARN
GHVMNITNNGPENEAKGDYVQNEKNANPTESLEKESAFRSKAEPISSSISNMELELNSSS
SKAPKKNRLRRKSSTRHTCALEFVVSRNPSPPDHGELQIDSCSSSEEMKKQHLDQMPVRH
SKTLQLMEGKEPATGARRGSKPGEQINKRFASHTFPELNLTNVPGFFANCSSSNKPQELV
NPSLQREEPEESLGRIQVSDSTRDPKELLLGGGRGLQTERSVESTRISLVPDTDYGTQDS
ISLLEADTLRKTKTAPNRRANLCAATENPKEPIHGCSKDTRNDTEGFADPLTREDNHTQE
TRIAMEESELDTQYLYNTFKVSKRQSFALFSNPEDPEKDCAMVCAHSGALRKQSPKVTLE
GGQKEENQGKKESEIKHVQAVHATAGFSAVSQQAKKPGDYAKCSIKGGSGLCQSSLFRGK
EAELLIANNHGISQNPYHIPPLSPIRSSVKTLCKKNPSEERFEQHSMSPERAMGNESVIQ
STVSTISQNNIRESTLKEVSSSSVNEVGSSTNEVGSSGENIQAELGRHRGPKLNAMLRLG
LMQPEVYKQSPPVSNCKHPEMKRQGENEGVVLSVNADFSPCLISDNPEQPMGSTCASQVC
SETPDDLLNGDKIKGKSSFAESDIRERSAVFSKSVQKGAFRRSPLDETRLAQGHQRGARK
LESSEENTSSEEEELPCFQHLLFGKVTNTPSQPTRHNAVATEGLSKKTEENLDSRKSSLS
DLSNQGPSARASQEHYLSEEARCSGSLFSSQHSALEDLTVTTNSQDPFLMFDPPSKQVRH
QSENLDVLSDKALVSDDDDERELGLDEDNHEEQSVDSDLGEVASGYQSETSLSEDRSGLS
SQSDILTTQQRDTMQDNLIKLQQEMAELEAVLEQHGSQPSRSSPSLLAGSGAPEDLLNPE
QNTSEKAILTSEKSSDYPISQNPESLSADKFQVSLDSSTSKNKEPGTRRSSPSPSRLLDT
SWYVHSGPRNLQNTNCPSQKELIKVVSVEDQAPTRSEAQEVVEQSLSRPDLEGTPYLESG
ISLFSDDPESDPSADRAPEPAHVSSMPTSTSALKLPQFQVEESAKSTAAVDVANTAGYNK
REDTVGREKPEVISSVKRINRTISMVASGLTPKEFMLVEKFAKKHHIALTNQISEETTHV
IMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKILDEHDFEVRGDVVNGRNHQ
GPKRARESRDRKIFRGLEVCCYGPFTNMPTDQLEWMVHLCGASVVKEPSSFTLSKGTHPV
VVVQPDAWADDSGFHAIGQMCEALVVTREWVLDSVALYQCQELDTYLIPQIRRAAAHASQ
PCP
NT seq 5592 nt   +upstreamnt  +downstreamnt
atggatttacctgcggatcgtgttgaagaagtacaaaatgtccttaatgccatgcagaaa
atcttagagtgtccaatctgtctggagttgatcaaagagcctgtttccacgaagtgtgat
cacatattttgcaagttttgtatgctgaaacttctcaaccagaggaaaggaccttcacaa
tgtcctttgtgtaagaacgatataaccaaaagaagcctacaagaaagtacaagatttagt
caacttgttgaagagctgttgaaaatcattcatgctttcgagctggacacaggattgcag
tttgcaaacagctataatttttcaaaaaaggaaaataactctcctgaccatctaaaggag
gaagtttctattatccaaagtatgggctatcgaaaccgtgccaaaagacttcgacagagt
gagcctgaaaaccctgccttgcaggaaaccagtcttagtgtccacctctctgaccttgga
attgtgagatctctgaggacaaagcagcagatacagcctcagaataagtctgtctacatt
gaattgggatctgattcttctgaagatacagttaataaggcaagttattgcagtgtggga
gacgacgagttgttacaaatcacccctcaaggagccagggctgaagccagtttgaatcct
gcaaaaaaggctgcctgtgaaatttctgaggacataacaaatattgaacatcatcaatcc
ggtaataaagatttgaccaccactgagaagcatgcaactgagaagcatccagaaaagtat
cagggtatttctgtttcaaacttgcatgtggagccatgtggcacaaatactcataccagc
tcattacagcatgagaacagcagtttattactcactaaagacagaatgaatgtagaaaag
gctgaattctgtaataaaagcaaacagcttggctcagcaaggagccaacagagcagatgg
gctggaagtaaggaaacatgtaatgataggcagactcccagcacagagaaaaaggtactt
ctgaatgctgatcccctgcatgggagaaaagaaccgaggaagcagaaacctgcatgctct
gacagtcctagagattcccaagatgttccttggataacgctgaatagtagcgtacagaaa
gttaatgagtggttttccagaagtgatggaatgttaccttctgatgactcacatgatggg
ggctctgactcgaatactggagtagctggtgcggtagaagttccaaatgaagtggacgga
tattctggttcttctgagaaagtagatttaatggccagtgatcctcaggttgctttgata
cgtggaagtgaaagagtccaccccaagtcagtagagagtaatatcgaagataaaatattt
gggaaaacctaccggaggagggcgagcctccctagccacacgaatgaagacctaattata
ggatttcgtgctatagaacctcagacaacgcgagcccatcccctcacaaataaagcaaag
tgtaaaaggagaactacatcaggccttcttcctgaggattttatcaagaaagtagatttg
gccgttgttccaaagactcctgaaaagctagttgagggaaccaaccaaatcgcacgaaat
ggtcacgtgatgaatattacaaataacggtcctgagaatgaagcaaaaggtgattatgtt
cagaacgagaaaaatgctaacccaacagaatcattggaaaaagaatctgcttttagaagc
aaagctgaaccgataagcagcagtataagcaatatggaactggaattaaatagctccagt
tcgaaagcccctaagaagaacaggctgaggaggaagtcctccaccaggcacacttgtgca
cttgaattcgtagtcagtagaaatccaagcccgcctgatcatggcgaactacagatcgat
agttgttctagcagtgaagagatgaagaaacagcatttggaccaaatgccagtcagacac
agcaaaacgcttcagctcatggaaggtaaagaacctgcaactggagccaggaggggcagt
aagccaggggaacagataaataagagatttgccagtcatacttttccagagctaaatttg
acaaacgtgcctggtttttttgctaactgttcaagttctaataaacctcaagagcttgtc
aaccctagccttcaaagagaagaaccagaagagagcctaggaaggattcaagtgtctgat
agtaccagagatcccaaagagctgctcttgggtggaggaagaggtttgcaaactgaaaga
tctgtggagagtacccgtatttcactggtacctgatactgattacggcactcaggacagt
atctcgttgctggaagctgacaccctaaggaagacaaaaacagcaccaaatcgacgtgcg
aatctgtgcgcagcaactgaaaaccccaaggaacctatccacggttgttctaaagatact
agaaatgacacagagggttttgcagatccactgacacgtgaagataaccacactcaggag
acaagaatagcaatggaagagagtgaacttgacacacagtatttatacaacacattcaag
gtttcaaagcgtcagtcatttgctctgttttcaaatccagaagatccagaaaaggactgt
gcaatggtctgtgcccactccggggccttaaggaaacaaagtccaaaagtcactcttgaa
ggtggacaaaaagaagaaaatcagggaaagaaagagtctgaaatcaagcatgtgcaggca
gttcatgcaactgcaggcttttctgcagttagtcagcaagctaagaagccaggtgattat
gccaaatgtagcataaaaggaggctctgggctttgtcagtcatctctgttcagaggcaag
gaagctgaactccttattgcaaataaccatggaatttcccagaacccttaccatatacca
ccactttctcccatcagatcatctgttaaaactctatgtaagaaaaacccgtcagaggaa
aggtttgagcagcattcaatgtcacctgaaagagcaatgggaaatgagagcgtcattcaa
agtacagtgagcacaattagccaaaataacattagagaaagcactttgaaggaagtcagc
tcaagcagtgttaatgaagtgggttccagtactaatgaagtgggttccagtggtgaaaac
attcaggcagaactaggtagacaccgaggacctaaattaaatgctatgctcagattaggt
cttatgcaacctgaagtctataagcaaagccctcctgtaagtaattgtaaacatccggaa
atgaaaaggcaaggagaaaatgaaggcgtagttctgtctgttaatgcagatttctctcca
tgtctaatttcagataaccccgaacaaccgatgggaagcacttgcgcttctcaggtttgt
tcggagacacctgatgacctattaaatggtgacaaaataaagggaaaaagcagctttgct
gaaagtgacattagggaaagatctgctgtttttagcaaaagtgtccagaaaggagccttc
agaagaagccctttagacgaaacacgtttggcccagggtcaccaaagaggggccaggaaa
ttagagtcctcggaagagaacacatccagtgaagaggaagagcttccatgcttccaacac
ttactatttggtaaagtaaccaacacaccttctcagcctacccgtcacaatgctgttgcc
acagagggtctgtctaagaaaacagaggagaacctagactcacggaagagtagtttaagt
gacctcagtaaccagggaccatcagcaagggcatcccaggaacattatcttagtgaggaa
gcaaggtgttctgggagcttattttcttcacagcacagtgcattggaagacttgacagtg
actacaaacagccaggatcctttcttgatgttcgatcccccttccaaacaagtgaggcat
cagtctgaaaacctggatgttctgagcgacaaggcattggtttcagatgatgatgatgaa
agggagcttggcctggacgaagataatcacgaagaacagagtgtggattcagacttaggt
gaagtggcatccgggtatcagagtgaaacaagcctctctgaagaccgttcagggttgtcc
tctcagagtgatattctaaccactcagcagagggataccatgcaagataacctgataaag
ctccagcaggaaatggccgaactggaagccgtgttagagcagcacgggagccagccttct
cgcagctccccttccctcctagcaggttctggtgccccggaggatctgctaaatccggaa
caaaacacatcagaaaaagcaatattaacttcagagaaaagtagtgactatcctataagc
cagaatcccgaaagcctttctgctgacaaatttcaagtatctctggatagttccaccagt
aaaaataaagaaccaggaacaagaaggtcttccccttctccatcccggttgttagatacc
agttggtatgtgcacagcggcccaaggaatcttcagaacacaaactgcccgtctcaaaag
gagctcattaaggtcgtcagtgtggaggaccaagcaccgactaggtcagaggcccaagag
gtcgtggagcagtctttgtcaagaccagatctggagggaaccccttacctcgagtctgga
atcagcctcttctctgatgaccctgagtctgacccctctgcagacagagccccagagcca
gctcatgttagcagcatgccaacttcaacctctgctttgaaattaccccaatttcaagtt
gaagaatcagccaagagtacagctgctgtcgatgttgctaatactgctgggtataataag
agggaagacactgtgggcagggagaagccagaagttatatcttcagtaaaaagaatcaac
agaacaatatctatggtggcatcaggcttaaccccaaaagaatttatgcttgtggagaag
tttgccaaaaaacaccacatcgctttaacgaatcaaatttctgaagagactactcatgtc
atcatgaaaacagatgctgagtttgtgtgcgaacggacactgaaatattttctgggtatc
gcaggaggaaaatgggtagttagctatttctgggtgacccagtctattaaagaaagaaag
atactagatgagcatgattttgaagtcagaggagatgttgtgaatggaagaaaccaccaa
ggtccgaagcgagcaagagaatcccgggacagaaagatcttcaggggcctagaagtctgt
tgctatgggccctttaccaacatgcccacagatcagctagagtggatggtgcacctctgt
ggggcttctgtggtgaaggagccttcgtcattcactctcagcaagggtactcacccagtg
gtggtcgtgcagccggacgcctgggcggacgacagtggcttccatgcaattgggcagatg
tgtgaggcacttgtggtgacccgagagtgggtgttagacagtgtggccctctaccagtgc
caggagctggacacctacctgatcccgcagattcgcagagctgctgctcacgccagccag
ccatgtccgtag

DBGET integrated database retrieval system