KEGG   Ursus maritimus (polar bear): 103658194
Entry
103658194         CDS       T03271                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04380  Osteoclast differentiation
umr04390  Hippo signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05144  Malaria
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05220  Chronic myeloid leukemia
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05321  Inflammatory bowel disease
umr05323  Rheumatoid arthritis
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103658194 (TGFB2)
   04350 TGF-beta signaling pathway
    103658194 (TGFB2)
   04390 Hippo signaling pathway
    103658194 (TGFB2)
   04068 FoxO signaling pathway
    103658194 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103658194 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103658194 (TGFB2)
   04218 Cellular senescence
    103658194 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103658194 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658194 (TGFB2)
   05206 MicroRNAs in cancer
    103658194 (TGFB2)
   05205 Proteoglycans in cancer
    103658194 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103658194 (TGFB2)
   05212 Pancreatic cancer
    103658194 (TGFB2)
   05225 Hepatocellular carcinoma
    103658194 (TGFB2)
   05226 Gastric cancer
    103658194 (TGFB2)
   05220 Chronic myeloid leukemia
    103658194 (TGFB2)
   05211 Renal cell carcinoma
    103658194 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103658194 (TGFB2)
   05321 Inflammatory bowel disease
    103658194 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103658194 (TGFB2)
   05414 Dilated cardiomyopathy
    103658194 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103658194 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103658194 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103658194 (TGFB2)
   05161 Hepatitis B
    103658194 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103658194 (TGFB2)
   05144 Malaria
    103658194 (TGFB2)
   05145 Toxoplasmosis
    103658194 (TGFB2)
   05140 Leishmaniasis
    103658194 (TGFB2)
   05142 Chagas disease
    103658194 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103658194 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103658194 (TGFB2)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103658194 (TGFB2)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103658194 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 103658194
NCBI-ProteinID: XP_008683896
UniProt: A0A384BMU8
LinkDB
Position
Un
AA seq 414 aa
MHYCVLSAFLFLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgttcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagattctgagcaagctgaagctcaccagccccccagaagactatcccgaaccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcttgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgccc
actttctacagaccctacttcagaattgtccgatttgacgtctcggcgatggagaagaat
gcatccaatttggtgaaagcagagttcagagtctttcgtttacagaacccgaaagccagg
gtgccggaacaacggatcgaactgtatcagattctcaaatccaaagatttaacgtctcca
acccagcgctacattgacagtaaagttgtcaagacgagagcagaaggcgaatggctttcc
tttgacgtgactgacgccgtccatgaatggctccaccataaagacagaaacctgggattt
aaaataagtttgcactgtccctgctgcacctttgtaccatctaataattacatcattccc
aataaaagcgaagagctagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagacttgagtcacaacagtccaaccggcggaag
aagcgtgctttggatgcagcctattgttttagaaatgtgcaggataattgctgcctccgt
ccactttacatagatttcaagagggatcttgggtggaaatggatacatgaacctaaaggg
tacaatgccaacttctgtgctggagcgtgcccatatttatggagttcggacactcagcac
agtagggttctcagcctatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaggatttagaaccgctaaccattctctactacattggcaaaacacccaagatt
gaacaactctctaatatgatcgtcaagtcttgcaaatgcagctaa

KEGG   Ursus maritimus (polar bear): 103670922
Entry
103670922         CDS       T03271                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04390  Hippo signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05144  Malaria
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05220  Chronic myeloid leukemia
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05321  Inflammatory bowel disease
umr05323  Rheumatoid arthritis
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103670922 (TGFB3)
   04350 TGF-beta signaling pathway
    103670922 (TGFB3)
   04390 Hippo signaling pathway
    103670922 (TGFB3)
   04068 FoxO signaling pathway
    103670922 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103670922 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103670922 (TGFB3)
   04218 Cellular senescence
    103670922 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670922 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103670922 (TGFB3)
   05212 Pancreatic cancer
    103670922 (TGFB3)
   05225 Hepatocellular carcinoma
    103670922 (TGFB3)
   05226 Gastric cancer
    103670922 (TGFB3)
   05220 Chronic myeloid leukemia
    103670922 (TGFB3)
   05211 Renal cell carcinoma
    103670922 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103670922 (TGFB3)
   05321 Inflammatory bowel disease
    103670922 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103670922 (TGFB3)
   05414 Dilated cardiomyopathy
    103670922 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103670922 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103670922 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103670922 (TGFB3)
   05161 Hepatitis B
    103670922 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103670922 (TGFB3)
   05144 Malaria
    103670922 (TGFB3)
   05145 Toxoplasmosis
    103670922 (TGFB3)
   05140 Leishmaniasis
    103670922 (TGFB3)
   05142 Chagas disease
    103670922 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103670922 (TGFB3)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103670922 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103670922
NCBI-ProteinID: XP_008697662
UniProt: A0A384CS48
LinkDB
Position
Un
AA seq 412 aa
MKMHLQRALVVLALLTFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgacctttgccacggtc
agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgagccatcg
gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctg
gccgtctgccccaaagggatcacctccaaggttttccgcttcaacgtgtcctcagtggag
aaaaatggaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tccaagcgcagcgaacaaaggatcgagctcttccagatactccggcccgatgagcacatt
gccaaacagcgctatattggcggcaagaatctgcccacacggggcaccgccgagtggctg
tcctttgacgtcactgacactgtgcgtgagtggctcttgcgaagagagtccaacttaggt
ctggaaatcagcattcactgtccatgtcacacctttcagcccaatggtgacatcctggaa
aacattcatgaggtgatggaaatcaaattcaaaggtgtggacagcgaggatgatcatggc
cgtggggacctagggcgcctcaagaagcagaaggaccaccacaaccctcacctcatcctg
atgatgattcccccgcaccggctggacaacccgggccagggcgggcagaggaagaagcgg
gccctggacaccaattactgcttccgcaatttggaggagaattgctgtgtgcgccctctc
tacattgacttccgacaagatctgggctggaaatgggtccatgaacctaagggctactac
gccaacttctgctcaggcccttgcccctacctccgcagcgcggacacaacccacagcacg
gtgctgggactgtacaacactctgaatcctgaagcatctgcctcaccttgctgtgtgccc
caggacttggagcccctgaccatcctgtactacgtcgggaggacccccaaggtggaacag
ctgtctaacatggtggtcaagtcctgtaagtgtagctga

KEGG   Ursus maritimus (polar bear): 103677394
Entry
103677394         CDS       T03271                                 

Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04380  Osteoclast differentiation
umr04390  Hippo signaling pathway
umr04659  Th17 cell differentiation
umr04672  Intestinal immune network for IgA production
umr04926  Relaxin signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05144  Malaria
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05220  Chronic myeloid leukemia
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05321  Inflammatory bowel disease
umr05323  Rheumatoid arthritis
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103677394
   04350 TGF-beta signaling pathway
    103677394
   04390 Hippo signaling pathway
    103677394
   04068 FoxO signaling pathway
    103677394
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103677394
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103677394
   04218 Cellular senescence
    103677394
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103677394
   04672 Intestinal immune network for IgA production
    103677394
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103677394
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103677394
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103677394
   05205 Proteoglycans in cancer
    103677394
  09162 Cancer: specific types
   05210 Colorectal cancer
    103677394
   05212 Pancreatic cancer
    103677394
   05225 Hepatocellular carcinoma
    103677394
   05226 Gastric cancer
    103677394
   05220 Chronic myeloid leukemia
    103677394
   05211 Renal cell carcinoma
    103677394
  09163 Immune disease
   05323 Rheumatoid arthritis
    103677394
   05321 Inflammatory bowel disease
    103677394
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103677394
   05414 Dilated cardiomyopathy
    103677394
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103677394
   04933 AGE-RAGE signaling pathway in diabetic complications
    103677394
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103677394
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103677394
   05161 Hepatitis B
    103677394
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103677394
   05144 Malaria
    103677394
   05145 Toxoplasmosis
    103677394
   05140 Leishmaniasis
    103677394
   05142 Chagas disease
    103677394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:umr03110]
    103677394
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103677394
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103677394
Chaperones and folding catalysts [BR:umr03110]
 Intramolecular chaperones
  Others
   103677394
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103677394
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103677394
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 103677394
NCBI-ProteinID: XP_008704878
UniProt: A0A384DCY6
LinkDB
Position
Un
AA seq 207 aa
MEVLNKGEQFLQAWPEPEPEADYYAKEVTRVLMVENTNKIYEKIKKSPHSIYMLFNTSEL
REAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWRYLSNRLLAPSDTPEWLSFDV
TGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINGFSSSRRGDLATIHGMNRPFLLL
MATPLERAQHLHSSRHRRALDTNYCFR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggaagtgctcaataaaggagagcagttcttacaggcgtggccggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacaaaatc
tatgagaaaatcaagaaaagcccacacagcatctatatgctcttcaacacatcggagctc
cgagaagcagtgcccgagcccgtcttgctctcccgggcggagctgcgcctgctgaggctc
aagttgaaagccgagcagcacgtggagctgtaccagaaatatagcaacgattcctggcgc
tacctcagcaaccggctgctggcgcccagcgacacgccagaatggctgtccttcgatgtc
acaggagtcgtgcgacagtggctgagccatggaggggaagtagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataatacactgcaagtggatatcaacgggttcagt
tccagccgccgaggtgacctggccaccattcacggcatgaaccggcccttcctgctcctc
atggccaccccactggagagggcccagcacctgcacagctcccggcatcgccgggccctg
gacaccaactactgcttcaggtga

DBGET integrated database retrieval system