Ursus maritimus (polar bear): 103658194 Help Entry 103658194         CDS       T03271                                  Gene name TGFB2 Definition (RefSeq) transforming growth factor beta 2   KO K13376   transforming growth factor beta-2 Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04060   Cytokine-cytokine receptor interaction umr04068   FoxO signaling pathway umr04110   Cell cycle umr04218   Cellular senescence umr04350   TGF-beta signaling pathway umr04380   Osteoclast differentiation umr04390   Hippo signaling pathway umr04933   AGE-RAGE signaling pathway in diabetic complications umr05140   Leishmaniasis umr05142   Chagas disease umr05144   Malaria umr05145   Toxoplasmosis umr05146   Amoebiasis umr05152   Tuberculosis umr05161   Hepatitis B umr05166   Human T-cell leukemia virus 1 infection umr05200   Pathways in cancer umr05205   Proteoglycans in cancer umr05206   MicroRNAs in cancer umr05210   Colorectal cancer umr05211   Renal cell carcinoma umr05212   Pancreatic cancer umr05220   Chronic myeloid leukemia umr05225   Hepatocellular carcinoma umr05226   Gastric cancer umr05321   Inflammatory bowel disease umr05323   Rheumatoid arthritis umr05410   Hypertrophic cardiomyopathy umr05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103658194 (TGFB2)    04350 TGF-beta signaling pathway     103658194 (TGFB2)    04390 Hippo signaling pathway     103658194 (TGFB2)    04068 FoxO signaling pathway     103658194 (TGFB2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103658194 (TGFB2)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103658194 (TGFB2)    04218 Cellular senescence     103658194 (TGFB2)  09150 Organismal Systems   09158 Development and regeneration    04380 Osteoclast differentiation     103658194 (TGFB2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103658194 (TGFB2)    05206 MicroRNAs in cancer     103658194 (TGFB2)    05205 Proteoglycans in cancer     103658194 (TGFB2)   09162 Cancer: specific types    05210 Colorectal cancer     103658194 (TGFB2)    05212 Pancreatic cancer     103658194 (TGFB2)    05225 Hepatocellular carcinoma     103658194 (TGFB2)    05226 Gastric cancer     103658194 (TGFB2)    05220 Chronic myeloid leukemia     103658194 (TGFB2)    05211 Renal cell carcinoma     103658194 (TGFB2)   09163 Immune disease    05323 Rheumatoid arthritis     103658194 (TGFB2)    05321 Inflammatory bowel disease     103658194 (TGFB2)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103658194 (TGFB2)    05414 Dilated cardiomyopathy     103658194 (TGFB2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103658194 (TGFB2)   09171 Infectious disease: bacterial    05152 Tuberculosis     103658194 (TGFB2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103658194 (TGFB2)    05161 Hepatitis B     103658194 (TGFB2)   09174 Infectious disease: parasitic    05146 Amoebiasis     103658194 (TGFB2)    05144 Malaria     103658194 (TGFB2)    05145 Toxoplasmosis     103658194 (TGFB2)    05140 Leishmaniasis     103658194 (TGFB2)    05142 Chagas disease     103658194 (TGFB2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:umr04052]     103658194 (TGFB2)    00536 Glycosaminoglycan binding proteins [BR:umr00536]     103658194 (TGFB2) Cytokines and growth factors [BR:umr04052]  Cytokines   Transforming growth factors (RSTK binding)    103658194 (TGFB2) Glycosaminoglycan binding proteins [BR:umr00536]  Heparan sulfate / Heparin   Growth factors/receptors    103658194 (TGFB2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TGFb_propeptide TGF_beta SPEG_u2 Motif Other DBs NCBI-GeneID:  103658194 NCBI-ProteinID:  XP_008683896 UniProt:  A0A384BMU8 LinkDB All DBs Position Un AA seq 414 aa AA seqDB search MHYCVLSAFLFLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt atgcactactgtgtgctgagcgcttttctgttcctgcatctggtcacggccgcgctcagc ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc cgcgggcagattctgagcaagctgaagctcaccagccccccagaagactatcccgaaccc gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag aaggcgagccggagggcggccgcttgcgagcgcgagaggagcgacgaggagtactacgcc aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgccc actttctacagaccctacttcagaattgtccgatttgacgtctcggcgatggagaagaat gcatccaatttggtgaaagcagagttcagagtctttcgtttacagaacccgaaagccagg gtgccggaacaacggatcgaactgtatcagattctcaaatccaaagatttaacgtctcca acccagcgctacattgacagtaaagttgtcaagacgagagcagaaggcgaatggctttcc tttgacgtgactgacgccgtccatgaatggctccaccataaagacagaaacctgggattt aaaataagtttgcactgtccctgctgcacctttgtaccatctaataattacatcattccc aataaaagcgaagagctagaagcaagatttgcaggtattgatggcacctccacatatacc agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat ctcctgctaatgttgttgccctcctacagacttgagtcacaacagtccaaccggcggaag aagcgtgctttggatgcagcctattgttttagaaatgtgcaggataattgctgcctccgt ccactttacatagatttcaagagggatcttgggtggaaatggatacatgaacctaaaggg tacaatgccaacttctgtgctggagcgtgcccatatttatggagttcggacactcagcac agtagggttctcagcctatataataccataaatccagaagcatctgcttctccttgctgc gtgtcccaggatttagaaccgctaaccattctctactacattggcaaaacacccaagatt gaacaactctctaatatgatcgtcaagtcttgcaaatgcagctaa

Ursus maritimus (polar bear): 103670922 Help Entry 103670922         CDS       T03271                                  Gene name TGFB3 Definition (RefSeq) transforming growth factor beta 3   KO K13377   transforming growth factor beta-3 Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04060   Cytokine-cytokine receptor interaction umr04068   FoxO signaling pathway umr04110   Cell cycle umr04218   Cellular senescence umr04350   TGF-beta signaling pathway umr04390   Hippo signaling pathway umr04933   AGE-RAGE signaling pathway in diabetic complications umr05140   Leishmaniasis umr05142   Chagas disease umr05144   Malaria umr05145   Toxoplasmosis umr05146   Amoebiasis umr05152   Tuberculosis umr05161   Hepatitis B umr05166   Human T-cell leukemia virus 1 infection umr05200   Pathways in cancer umr05210   Colorectal cancer umr05211   Renal cell carcinoma umr05212   Pancreatic cancer umr05220   Chronic myeloid leukemia umr05225   Hepatocellular carcinoma umr05226   Gastric cancer umr05321   Inflammatory bowel disease umr05323   Rheumatoid arthritis umr05410   Hypertrophic cardiomyopathy umr05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103670922 (TGFB3)    04350 TGF-beta signaling pathway     103670922 (TGFB3)    04390 Hippo signaling pathway     103670922 (TGFB3)    04068 FoxO signaling pathway     103670922 (TGFB3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103670922 (TGFB3)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103670922 (TGFB3)    04218 Cellular senescence     103670922 (TGFB3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103670922 (TGFB3)   09162 Cancer: specific types    05210 Colorectal cancer     103670922 (TGFB3)    05212 Pancreatic cancer     103670922 (TGFB3)    05225 Hepatocellular carcinoma     103670922 (TGFB3)    05226 Gastric cancer     103670922 (TGFB3)    05220 Chronic myeloid leukemia     103670922 (TGFB3)    05211 Renal cell carcinoma     103670922 (TGFB3)   09163 Immune disease    05323 Rheumatoid arthritis     103670922 (TGFB3)    05321 Inflammatory bowel disease     103670922 (TGFB3)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103670922 (TGFB3)    05414 Dilated cardiomyopathy     103670922 (TGFB3)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103670922 (TGFB3)   09171 Infectious disease: bacterial    05152 Tuberculosis     103670922 (TGFB3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103670922 (TGFB3)    05161 Hepatitis B     103670922 (TGFB3)   09174 Infectious disease: parasitic    05146 Amoebiasis     103670922 (TGFB3)    05144 Malaria     103670922 (TGFB3)    05145 Toxoplasmosis     103670922 (TGFB3)    05140 Leishmaniasis     103670922 (TGFB3)    05142 Chagas disease     103670922 (TGFB3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:umr04052]     103670922 (TGFB3) Cytokines and growth factors [BR:umr04052]  Cytokines   Transforming growth factors (RSTK binding)    103670922 (TGFB3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TGFb_propeptide TGF_beta Motif Other DBs NCBI-GeneID:  103670922 NCBI-ProteinID:  XP_008697662 UniProt:  A0A384CS48 LinkDB All DBs Position Un AA seq 412 aa AA seqDB search MKMHLQRALVVLALLTFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS VMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNEL AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHI AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt atgaagatgcacttgcaaagggctctggtggtcctggccctgctgacctttgccacggtc agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg gaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgagccatcg gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg gaggagatgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtac tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctg gccgtctgccccaaagggatcacctccaaggttttccgcttcaacgtgtcctcagtggag aaaaatggaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc tccaagcgcagcgaacaaaggatcgagctcttccagatactccggcccgatgagcacatt gccaaacagcgctatattggcggcaagaatctgcccacacggggcaccgccgagtggctg tcctttgacgtcactgacactgtgcgtgagtggctcttgcgaagagagtccaacttaggt ctggaaatcagcattcactgtccatgtcacacctttcagcccaatggtgacatcctggaa aacattcatgaggtgatggaaatcaaattcaaaggtgtggacagcgaggatgatcatggc cgtggggacctagggcgcctcaagaagcagaaggaccaccacaaccctcacctcatcctg atgatgattcccccgcaccggctggacaacccgggccagggcgggcagaggaagaagcgg gccctggacaccaattactgcttccgcaatttggaggagaattgctgtgtgcgccctctc tacattgacttccgacaagatctgggctggaaatgggtccatgaacctaagggctactac gccaacttctgctcaggcccttgcccctacctccgcagcgcggacacaacccacagcacg gtgctgggactgtacaacactctgaatcctgaagcatctgcctcaccttgctgtgtgccc caggacttggagcccctgaccatcctgtactacgtcgggaggacccccaaggtggaacag ctgtctaacatggtggtcaagtcctgtaagtgtagctga

Ursus maritimus (polar bear): 103677394 Help Entry 103677394         CDS       T03271                                  Definition (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04060   Cytokine-cytokine receptor interaction umr04068   FoxO signaling pathway umr04110   Cell cycle umr04218   Cellular senescence umr04350   TGF-beta signaling pathway umr04380   Osteoclast differentiation umr04390   Hippo signaling pathway umr04659   Th17 cell differentiation umr04672   Intestinal immune network for IgA production umr04926   Relaxin signaling pathway umr04932   Non-alcoholic fatty liver disease umr04933   AGE-RAGE signaling pathway in diabetic complications umr05140   Leishmaniasis umr05142   Chagas disease umr05144   Malaria umr05145   Toxoplasmosis umr05146   Amoebiasis umr05152   Tuberculosis umr05161   Hepatitis B umr05166   Human T-cell leukemia virus 1 infection umr05200   Pathways in cancer umr05205   Proteoglycans in cancer umr05210   Colorectal cancer umr05211   Renal cell carcinoma umr05212   Pancreatic cancer umr05220   Chronic myeloid leukemia umr05225   Hepatocellular carcinoma umr05226   Gastric cancer umr05321   Inflammatory bowel disease umr05323   Rheumatoid arthritis umr05410   Hypertrophic cardiomyopathy umr05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103677394    04350 TGF-beta signaling pathway     103677394    04390 Hippo signaling pathway     103677394    04068 FoxO signaling pathway     103677394   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103677394  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103677394    04218 Cellular senescence     103677394  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     103677394    04672 Intestinal immune network for IgA production     103677394   09152 Endocrine system    04926 Relaxin signaling pathway     103677394   09158 Development and regeneration    04380 Osteoclast differentiation     103677394  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103677394    05205 Proteoglycans in cancer     103677394   09162 Cancer: specific types    05210 Colorectal cancer     103677394    05212 Pancreatic cancer     103677394    05225 Hepatocellular carcinoma     103677394    05226 Gastric cancer     103677394    05220 Chronic myeloid leukemia     103677394    05211 Renal cell carcinoma     103677394   09163 Immune disease    05323 Rheumatoid arthritis     103677394    05321 Inflammatory bowel disease     103677394   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103677394    05414 Dilated cardiomyopathy     103677394   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103677394    04933 AGE-RAGE signaling pathway in diabetic complications     103677394   09171 Infectious disease: bacterial    05152 Tuberculosis     103677394   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103677394    05161 Hepatitis B     103677394   09174 Infectious disease: parasitic    05146 Amoebiasis     103677394    05144 Malaria     103677394    05145 Toxoplasmosis     103677394    05140 Leishmaniasis     103677394    05142 Chagas disease     103677394  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:umr03110]     103677394   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:umr04052]     103677394    00536 Glycosaminoglycan binding proteins [BR:umr00536]     103677394 Chaperones and folding catalysts [BR:umr03110]  Intramolecular chaperones   Others    103677394 Cytokines and growth factors [BR:umr04052]  Cytokines   Transforming growth factors (RSTK binding)    103677394 Glycosaminoglycan binding proteins [BR:umr00536]  Heparan sulfate / Heparin   Growth factors/receptors    103677394 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  103677394 NCBI-ProteinID:  XP_008704878 UniProt:  A0A384DCY6 LinkDB All DBs Position Un AA seq 207 aa AA seqDB search MEVLNKGEQFLQAWPEPEPEADYYAKEVTRVLMVENTNKIYEKIKKSPHSIYMLFNTSEL REAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWRYLSNRLLAPSDTPEWLSFDV TGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINGFSSSRRGDLATIHGMNRPFLLL MATPLERAQHLHSSRHRRALDTNYCFR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggaagtgctcaataaaggagagcagttcttacaggcgtggccggagcccgagcctgag gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacaaaatc tatgagaaaatcaagaaaagcccacacagcatctatatgctcttcaacacatcggagctc cgagaagcagtgcccgagcccgtcttgctctcccgggcggagctgcgcctgctgaggctc aagttgaaagccgagcagcacgtggagctgtaccagaaatatagcaacgattcctggcgc tacctcagcaaccggctgctggcgcccagcgacacgccagaatggctgtccttcgatgtc acaggagtcgtgcgacagtggctgagccatggaggggaagtagagggctttcgcctcagt gcccactgttcctgtgacagcaaagataatacactgcaagtggatatcaacgggttcagt tccagccgccgaggtgacctggccaccattcacggcatgaaccggcccttcctgctcctc atggccaccccactggagagggcccagcacctgcacagctcccggcatcgccgggccctg gacaccaactactgcttcaggtga

DBGET integrated database retrieval system