KEGG   Ursus maritimus (polar bear): 103659146
Entry
103659146         CDS       T03271                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04520  Adherens junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04714  Thermogenesis
umr04810  Regulation of actin cytoskeleton
umr04928  Parathyroid hormone synthesis, secretion and action
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05215  Prostate cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103659146 (FGFR1)
   04014 Ras signaling pathway
    103659146 (FGFR1)
   04015 Rap1 signaling pathway
    103659146 (FGFR1)
   04020 Calcium signaling pathway
    103659146 (FGFR1)
   04151 PI3K-Akt signaling pathway
    103659146 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103659146 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103659146 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103659146 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103659146 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103659146 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103659146 (FGFR1)
   05205 Proteoglycans in cancer
    103659146 (FGFR1)
   05230 Central carbon metabolism in cancer
    103659146 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    103659146 (FGFR1)
   05215 Prostate cancer
    103659146 (FGFR1)
   05224 Breast cancer
    103659146 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103659146 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103659146 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103659146 (FGFR1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103659146 (FGFR1)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   103659146 (FGFR1)
CD molecules [BR:umr04090]
 Proteins
  103659146 (FGFR1)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103659146 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 FGFR3_TM V-set Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 103659146
NCBI-ProteinID: XP_008684851
UniProt: A0A384BQI7
LinkDB
Position
Un
AA seq 919 aa
MWGWKGLLFWAVLVTATLCTARPAPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIVIYCTGAFLISCMVGSVVVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLGAERRVLARGHFVPSHVLDRDPSPAPGA
ARGLGGGSGAGRPGELTGPSVSVVSASRKPELRWRGLVLGAAAILAFCSSSCTNSAPSPR
KGDKFSECFVFGCLEISFLGHLLVITALNTRIPAPQNLGTESASTLPPAPKAYSLRGYRE
IQKKIQFAFISAEQTGLLL
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgtggggctggaagggcctcctcttctgggctgtgctggtcacagccacactctgcacc
gccaggccggccccaaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccctggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtccagagcatcaactggctgcgggacggggtgcagctggtggaaagcaaccgtacccgc
atcacgggggaggaggtggaggtgcgggattccgtgcctgccgactccggcctctacgct
tgtgtgaccagcagcccctcgggcagcgacaccacctacttctccgtcaatgtctcagat
gctctcccctcctcggaggacgacgatgatgatgatgactcctcttcagaggagaaagag
acagataacaccaaaccaaaccgtatgcccgtggctccgtactggacatccccagaaaag
atggaaaagaaattgcacgcagtgccggctgccaagactgtgaagttcaaatgcccttcc
agtgggactcccaaccccacgctgcgctggttgaaaaatggcaaagaattcaaacctgac
cacaggattggagggtacaaggtccgttacgccacctggagcatcatcatggactccgtg
gtgccttcggataagggcaactacacctgcatcgtggagaacgaatatggcagcattaac
cacacctaccagctcgacgtcgtggagcggtcccctcaccggcccatcctgcaggcaggg
ctgcctgccaacaagaccgtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agtgacccacagccccatatccagtggctgaagcacatcgaggtgaatgggagtaagatt
ggtccagacaacctgccttatgtccagatcttgaagactgccggagttaataccaccgac
aaagagatggaagtgcttcacttaaggaatgtctcctttgaggacgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttttggaa
gccctggaagagaggccagcagtgatgacctcgcccctgtacctggagatcgtcatctac
tgcacgggggccttccttatctcctgcatggtggggtctgtcgtcgtctacaagatgaag
agcggcaccaagaagagcgacttccacagccagatggccgtgcacaagctggccaagagc
atccctctgcgcagacaggtgtcggctgattctagtgcgtccatgaactctggggttctg
ctggttcggccctcacgtctctcctctagtggaacccccatgctggccggggtctctgaa
tacgaacttcccgaagaccctcgctgggagctgcctcgagacaggctggttttaggcaaa
cccctgggagagggctgctttgggcaggtggtgttggcagaggccattgggctggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggatgcaacagag
aaagacctgtcagacctgatctcagaaatggagatgatgaagatgattgggaagcacaag
aacatcatcaacctgctgggggcctgcacgcaggacggtcctttgtacgtcatcgtggag
tatgcctccaaaggcaacctgcgggagtacctgcaggcccggcggcctcctgggctggag
tactgttacaaccccagccacaacccagaggagcagctctcctccaaggacctggtctcc
tgcgcctatcaggtggcccgaggcatggagtatctcgcctccaagaagtgcatacaccga
gacctggccgccaggaacgtgctggtgacggaggacaacgtgatgaagatcgcggacttc
ggcctcgcgcgggacattcaccacatcgactactataaaaagacaaccaacggccggctg
cctgtgaagtggatggcgcccgaggccctgttcgaccggatctacacccaccagagcgac
gtctggtcttttggggtgctcctgtgggaaatcttcactctgggaggctccccgtatcct
ggcgtgcctgtggaggagcttttcaagctgctgaaggagggtcatcggatggacaagccc
agtaactgcaccaatgagctgtacatgatgatgcgggattgctggcatgcggtaccctct
cagagacccaccttcaagcagctggtggaagacctgggagcggagaggcgggtacttgct
cgtggccacttcgtcccctcccacgtgttggaccgagacccctccccggcacctggcgct
gcccgagggctggggggcgggagcggagccggcaggcccggagagctgaccgggccttcg
gtgtcggtggtgtccgcctcacgtaagcctgagctccggtggcggggcctcgtcctcggg
gctgcagccatcttggctttctgtagttcttcctgtaccaactccgccccatcccccagg
aaaggggacaaattctctgaatgtttcgtgttcggctgcttggaaatttcctttctcggc
cacctgctggtgatcactgcactcaacacgcgcatccctgctcctcagaacctcggcacc
gaatctgctagtactctgccccctgcccctaaagcttactctttgcggggttaccgtgaa
atacagaagaaaattcagttcgctttcatttctgcagaacaaacaggattgctgctttaa

KEGG   Ursus maritimus (polar bear): 103660044
Entry
103660044         CDS       T03271                                 

Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04144  Endocytosis
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04510  Focal adhesion
umr04520  Adherens junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04730  Long-term depression
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103660044
   04014 Ras signaling pathway
    103660044
   04015 Rap1 signaling pathway
    103660044
   04066 HIF-1 signaling pathway
    103660044
   04068 FoxO signaling pathway
    103660044
   04151 PI3K-Akt signaling pathway
    103660044
   04152 AMPK signaling pathway
    103660044
   04150 mTOR signaling pathway
    103660044
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103660044
   04140 Autophagy - animal
    103660044
  09143 Cell growth and death
   04114 Oocyte meiosis
    103660044
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103660044
   04520 Adherens junction
    103660044
   04550 Signaling pathways regulating pluripotency of stem cells
    103660044
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103660044
   04914 Progesterone-mediated oocyte maturation
    103660044
  09156 Nervous system
   04730 Long-term depression
    103660044
  09149 Aging
   04211 Longevity regulating pathway
    103660044
   04213 Longevity regulating pathway - multiple species
    103660044
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103660044
   05202 Transcriptional misregulation in cancer
    103660044
   05205 Proteoglycans in cancer
    103660044
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103660044
   05214 Glioma
    103660044
   05218 Melanoma
    103660044
   05215 Prostate cancer
    103660044
   05224 Breast cancer
    103660044
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103660044
   01522 Endocrine resistance
    103660044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103660044
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103660044
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103660044
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103660044
CD molecules [BR:umr04090]
 Proteins
  103660044
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Recep_L_domain Furin-like fn3 Kinase-like Furin-like_2 DUF4476 Insulin_TMD
Other DBs
NCBI-GeneID: 103660044
NCBI-ProteinID: XP_008685869
UniProt: A0A384BUF8
LinkDB
Position
Un
AA seq 1149 aa
MKRRVFPPRLNETVTVVYNTVIASLLRAAEPPVTGHYYYAGVCVPTCPPNTYRFEGWRCV
DRDFCANIPSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKK
TKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALV
SLSFLKNLRQILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVS
EIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTWKNHIIIRWHRYRPPDY
RDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVDPGILLQGLKPWTQY
AVYVKAVTLTMVNDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPN
GNLSYYIVRWQRQPQDSYLYRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGP
CCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVTQITNTTMSSRGRNST
VADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSAS
NFVFARTMPAEGADDIPGPVTWESRPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRE
CVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVPAKITYENFIHLII
ALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREK
ITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFN
CHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEIENNPVLAPPSLSKMIQMAGE
IADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRW
MSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCP
DMLFELMRMCWQYNPKMRPSFLEIISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPE
NMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERA
LPLPQSSTC
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgaaacgcagggtatttcctccccgccttaatgaaactgtgactgtggtctataatact
gtcattgcaagtctgctccgggctgcagagccccctgtcactgggcattactactacgcc
ggcgtctgcgtgcccacctgcccgcccaacacctaccgcttcgagggctggcgctgcgtg
gaccgcgacttctgcgccaacatccccagcgccgagagcagcgactccgaggggttcgtg
atccacgacggcgagtgcatgcaggagtgcccctccgggttcatccggaatggcagtcag
agtatgtactgcatcccttgcgaaggtccttgccccaaggtctgtgaggaagagaagaaa
acaaagaccattgattctgttacctctgctcaaatgctccaaggatgcaccatcttcaag
ggcaatttgctcattaacatccgccgaggcaataacattgcctcggaactggagaacttc
atggggctcatcgaggtggtgacaggctacgtgaagattcgccattcccacgccttggtc
tccttgtccttcctaaaaaaccttcgccagatcttaggagaggagcagctggaggggaac
tactccttctacgtccttgacaaccagaacttgcagcagctgtgggactgggaccaccgc
aacctgaccatcaaagctgggaaaatgtactttgctttcaatcccaagttgtgcgtctcc
gagatttaccgcatggaggaagtgacagggactaaggggcgccagagcaaaggggacata
aacaccaggaacaacggagagcgagcctcctgtgaaagcgacgtcctgcacttcacctct
acgaccacatggaagaatcacatcatcataaggtggcaccgttaccggccccccgactac
agggacctcatcagcttcactgtctactacaaggaagcaccttttaaaaacgtcacggag
tacgatggccaggatgcctgtggctccaacagctggaacatggtggatgtggacctccct
cccaacaaggacgtcgatcctggcattttactgcagggactgaagccctggacgcagtat
gccgtgtatgtcaaggcggtgaccctcaccatggtgaacgaccacatccgtggggccaag
agtgaaatcttgtacattcgtaccaatgcttcagttccttccattcccctggacgttctg
tccgcgtccaactcgtcttctcagctcatcgtgaagtggaacccgccgtccctgcccaac
gggaacctcagttactacatcgtgaggtggcagcggcagcctcaggacagctacctgtac
cggcacaattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatc
gacgtcgaagaggtgacggagaatcccaagaccgaggtgtgcggcggagagaaggggcct
tgctgcgcctgccccaaaaccgaggccgagaagcaggccgagaaggaggaggccgagtac
cgcaaagtcttcgagaacttcctgcacaactccatctttgtgcccagaccggaaaggaag
cggagagacgtcacacaaatcaccaacaccaccatgtccagccgaggcaggaacagcaca
gtggcggacacctataatatcacagacccagaagagctcgagacagaataccctttcttt
gagagcagagtagataacaaggagagaactgtcatctctaacctccggccttttactttg
taccgcattgacatccacagctgtaaccatgaggctgagaagctgggctgcagcgcctcc
aactttgtttttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccggtg
acctgggagtcgaggcctgaaaactccatctttctaaagtggccagaacctgagaatccc
aatggattgattctaatgtatgaaataaaatacggatcacaaatcgaggatcagcgggaa
tgtgtatccagacaggagtacaggaaatatggaggcgccaagcttaaccggctcaacccg
gggaactatacagcccggatccaggccacctctctctccgggaatgggtcgtggacggat
cctgtgttcttctatgtcccagccaaaataacgtatgaaaacttcatccatctgatcata
gctctgcccgttgccgtcctgttgatagtgggagggctggttataatgttgtacgtcttc
cacaggaaaagaaataacagcaggctggggaatggagtgctgtacgcgtccgtgaaccca
gagtacttcagcgccgccgacgtgtacgtacctgacgagtgggaggttgctcgagagaag
atcaccatgagccgagagctgggccagggctcctttgggatggtatacgaaggagtcgcc
aaaggcgtggttaaagatgagcccgaaaccagggtggccattaaaacagtgaacgaggct
gcgagcatgcgcgaaaggattgaatttctcaatgaggcttcagtgatgaaggagttcaat
tgtcaccacgtggtgcggttgctgggcgtggtgtcccagggccagccgacgctggtcatc
atggaactgatgacacggggggatctcaaaagctatctcaggtctctgaggccagaaata
gagaataatccagtcctagcacctccaagcctgagcaagatgatccagatggctggggag
attgcagatggcatggcatacctcaacgccaacaagtttgtccacagagaccttgctgcc
cggaactgcatggtggccgaagatttcacggtcaaaatcggagatttcggtatgacaaga
gacatctatgagacagactattacaggaaaggaggaaaggggctgctgcctgtgcgctgg
atgtcccccgagtctctcaaggatggagtcttcaccactcactctgacgtctggtccttc
ggggtcgtgctctgggagattgccacgctggccgaacagccataccagggcttgtccaac
gagcaggtccttcgcttcgtgatggagggcggccttctggacaagccggacaactgcccc
gacatgctgtttgaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttcc
ttcctggagatcatcagcagcatcaaggacgagatggagcccggcttccgggaggtctcc
ttctactacagcgaggagaacaagccgcccgagccggaggagctggacctggagcccgag
aacatggagagcgtccccctggacccctccgcctcctcgtcctccctgccgctgcccgac
agacactcaggacacaaggccgagaacggcccaggccccggcgtgctggtcctccgagcc
agcttcgatgagagacagccttacgcgcacatgaacgggggacgcaagaacgagagggcc
ttgcctctgccccagtcttcgacctgctga

KEGG   Ursus maritimus (polar bear): 103664600
Entry
103664600         CDS       T03271                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103664600 (PDGFRB)
   04014 Ras signaling pathway
    103664600 (PDGFRB)
   04015 Rap1 signaling pathway
    103664600 (PDGFRB)
   04630 JAK-STAT signaling pathway
    103664600 (PDGFRB)
   04020 Calcium signaling pathway
    103664600 (PDGFRB)
   04072 Phospholipase D signaling pathway
    103664600 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    103664600 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103664600 (PDGFRB)
   04540 Gap junction
    103664600 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103664600 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664600 (PDGFRB)
   05206 MicroRNAs in cancer
    103664600 (PDGFRB)
   05230 Central carbon metabolism in cancer
    103664600 (PDGFRB)
   05231 Choline metabolism in cancer
    103664600 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    103664600 (PDGFRB)
   05218 Melanoma
    103664600 (PDGFRB)
   05215 Prostate cancer
    103664600 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103664600 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103664600 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103664600 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103664600 (PDGFRB)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103664600 (PDGFRB)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103664600 (PDGFRB)
CD molecules [BR:umr04090]
 Proteins
  103664600 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set C2-set_2 Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 103664600
NCBI-ProteinID: XP_008690736
UniProt: A0A384C771
LinkDB
Position
Un
AA seq 1099 aa
MQLPSAVPAPVLKGQVLLLPLLLLLGPQASWGLVISPPGPELILNVSSNFVLTCSGPAPV
VWERMSQEPLQKMAKTQDGTFSSTLTLTNVSGIDTGEYFCTYKGSHGLEPGERKRLYIFV
PDPLMGFLPVDPEELFIFLTEITEITIPCRVTDPRLVVTLHEKKVDIPLPIPYDHQRGFS
GTFEDKTYVCKTTIGDKEVDSEAYYVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFNMPSHIRSILHIPSAELGDSGTYICNVSESVNEH
RDEKSINVTVVESGYVRLLGELDAIQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTLGDS
SAGEISLSTRNVSETRYVSELTLVRVKVAEAGCYTMRAFHEDAEAQLSFQLQVNVPVRVL
ELSENHPASGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSEEESQLETNV
TYWPEEQEFEVVSTLRLRRVDQPLSVRCTLHNLLGHDMQEVTVVPHSLPFKVVVISAILA
LVVLTIISLIILVMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLDLLARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIXXXXXXXXXXLHRNKHTFLQRCPDKRRPPSAELYSNALPGD
LPLPSHVSLPRESDGGYMDMSKDESVDYVPMLAMKGGVKYADIESSSYMAPYDNYVPTAP
ERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKIC
DFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTP
YPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLG
EGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYII
PLPDPKPEVADEGPLESSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPQPEPQGEPEXA
TPLESSCPGPRAETEDSFL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgcagcttccgagcgcagtgccagctcctgtcctcaaaggccaggtgctactgctgccc
ctgctgttgctgctgggcccacaggcctcctggggcctggtcatctcacccccggggcca
gagcttatcctcaatgtctccagcaactttgtgctgacctgctcaggtccagctccggtg
gtgtgggaacggatgtcccaggagcccctgcagaaaatggccaagacccaggatggcacc
ttctccagcacactgacactgaccaatgtctctgggatagacacgggagaatacttttgc
acctacaaaggctcccatgggctggagcctggggagcggaaacggctctacatctttgtg
ccagatcccttgatgggctttctcccggtcgaccccgaggaactattcatcttcctcacg
gaaataactgagatcacaattccatgccgagtgacggatccgagactggtggtgacactg
cacgagaagaaagtggatatcccgctgcccattccctatgaccaccaacgtggcttctct
ggtacctttgaggacaagacctatgtctgcaaaaccaccatcggggacaaggaagtggat
tctgaagcctactatgtctacagcctccaggtgtcatccatcaatgtgtcagtgaatgca
gtgcagactgtggtccgtcagggtgagaacatcaccatcatgtgcattgtgactggaaat
gaggtggtcaacttcgaatggacatacccacgcatggagagcgggcggctggtggagcca
gtgactgacttcctcttcaatatgccctcccacatacgctccatcctgcacatccctagt
gctgagcttggcgattcagggacctacatctgcaatgtatcggagagcgtgaatgagcat
cgagatgaaaagtccatcaatgtcactgtggttgagagtggctacgtgcggctgctggga
gagctggacgccatacaattcgcggagctgcaccgcagccggactctgcaggtcgtgttc
gaggcctacccgccgcctactgtcatgtggttcaaggacaaccgcacgctaggcgactcc
agcgcaggcgagatctccctgtccacacgcaatgtgtctgagacccggtacgtgtcagaa
ctgacgttggtgcgggtgaaggtggccgaggcgggctgctacaccatgcgggccttccat
gaggacgcggaggcccagctctccttccagctgcaggtcaacgtgcctgtccgtgtgctg
gagctgagtgaaaaccaccctgccagcggggagcagacagtccgctgtcgcggcaggggc
atgccccagccacacctcacctggtctacctgcagcgacctcaaaagatgtccgcgtgag
ctgccgcccacgccgctggggaacagttcggaggaggagagccagctggagactaacgtg
acgtactggcccgaggagcaggagttcgaggtggtgagcacactgcgcctgcgccgtgtc
gatcagccgctgtcggtgcgctgcactctgcacaacctgctgggacacgacatgcaggag
gtcaccgtggtgccgcattctctgcccttcaaggtggtggtgatctcagccatcctggcc
ttggtggtcctcacaatcatctccctcatcatcctcgtcatgctctggcagaagaagcca
cgttacgagatccgatggaaggtgattgaatccgtgagctccgacggccatgagtacatc
tacgtggaccctatgcagctgccctacgactccacctgggagctgccgcgggaccagctt
gtgcttggacgcaccctcggttccggggcctttggccaggtggtggaggccacggctcac
ggcctgagccattcgcaggccacgatgaaagtggcggttaagatgcttgatttgctggcc
cgcagcagcgagaagcaggccctcatgtccgagctgaagatcatgagtcacctcgggccc
catctgaacgtggtcaacttgctgggggcctgcaccaaaggaggacccatctacatcann
nnnnnnnnnnnnnnnnnnnnnnnnnnnctgcaccgcaacaagcacaccttcctgcagcgc
tgccccgacaagcgccgcccgcccagcgccgagctctacagcaacgcgctgcccggcgat
ctcccgctgcccagccacgtgtctctgcccagggagagcgacggcggctacatggacatg
agcaaggatgagtccgtggactacgtgcccatgctggccatgaaaggaggcgtcaaatac
gcagacatcgagtcctccagctacatggccccttacgacaactacgtccccactgctcct
gagaggacctgtcgggcaactctgatcaacgagtccccagttcttagctacacggatctc
gtgggcttcagctaccaggtggccaacggcatggagttcctggcctccaagaactgtgtc
caccgagatctggcagccagaaatgtgctcatctgtgagggcaagctggtcaagatctgt
gactttggcctggctcgtgacatcatgcgagactcgaactatatctccaaaggcagcacc
ttcctgcctctgaagtggatggctcccgagagcatcttcaacagcctctataccaccctg
agcgacgtgtggtccttcgggatcctactctgggagatcttcaccctgggtggcacccct
tacccagagctgcccatgaacgaccagttctataacgccatcaagcgagggtaccgcatg
gcccagcctgcccacgcctccgacgagatttacgagatcatgcagaagtgctgggaagag
aagtttgagatccggcctcctttctcccagctggtgctgcttcttgagaggctgctgggc
gagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgaccaccca
gccgtccttcggtcccaagcccgcttgcctggcttccatggcctccgatctcccctggac
accagctctgtcctctacactgctgtgcagcccaacgagggtgacaacgactacatcatc
cccctgcctgaccccaaacctgaggttgctgatgagggcccactggagagttctcccagc
cttgccagctccaccctgaatgaggtcaacacctcctctaccatctcctgcgacagcccc
ctggagccccaagaggagcccgagccccagcccgagccccagggggagccggagnccgcc
actccactggagtcaagctgccctgggcctcgggccgagacggaggacagcttcctgtag

KEGG   Ursus maritimus (polar bear): 103672737
Entry
103672737         CDS       T03271                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103672737 (PDGFRA)
   04014 Ras signaling pathway
    103672737 (PDGFRA)
   04015 Rap1 signaling pathway
    103672737 (PDGFRA)
   04630 JAK-STAT signaling pathway
    103672737 (PDGFRA)
   04020 Calcium signaling pathway
    103672737 (PDGFRA)
   04072 Phospholipase D signaling pathway
    103672737 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    103672737 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103672737 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103672737 (PDGFRA)
   04540 Gap junction
    103672737 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103672737 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103672737 (PDGFRA)
   05206 MicroRNAs in cancer
    103672737 (PDGFRA)
   05230 Central carbon metabolism in cancer
    103672737 (PDGFRA)
   05231 Choline metabolism in cancer
    103672737 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    103672737 (PDGFRA)
   05218 Melanoma
    103672737 (PDGFRA)
   05215 Prostate cancer
    103672737 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103672737 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103672737 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103672737 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103672737 (PDGFRA)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103672737 (PDGFRA)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103672737 (PDGFRA)
CD molecules [BR:umr04090]
 Proteins
  103672737 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 103672737
NCBI-ProteinID: XP_008699701
UniProt: A0A384CY35
LinkDB
Position
Un
AA seq 1098 aa
MACEQFSGTMGTSLLAFLILGSLLTGPSRVFCQLSLPSILPNENEKVVQLNSSFSLRCFG
ESEVSWQYPMSEEENPNVEIRNEENNSGLFVAVLEVVSAAAAHTGLYTCYYNHTQTEETD
IEGRRIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRSNDGVVHAS
YDSRQGFNGTFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETI
VVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECA
ARQATKEVKEMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLK
DNLTLIENLTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLT
QVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWAILANNISN
IITEVHPRDRSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAV
LVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRD
GLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHL
GPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLN
PADDSTRSYVILSFENNGDYMDMKQADATQYVPMLERKEAAKYSDIQRSLYDRPASSKKK
SVLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKI
VKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSL
GGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVE
NLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGSLDEQR
LSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDID
MMDDIGIDSSDLVEDSFL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggcctgcgagcagttttccggaacgatggggacttcccttctggccttcctgatctta
ggctctctcctcacagggcccagccgagtcttctgccagctttcattaccctccatcctg
ccaaacgaaaatgaaaaggtcgtgcagctgaattcatccttttctctgagatgctttggg
gagagtgaagtgagctggcagtaccccatgtctgaagaagagaaccccaatgtggaaatc
agaaacgaggagaacaacagcggcctttttgtggccgtgctggaggtggtcagcgcggcg
gcggcgcacacgggcttgtacacctgctattacaaccacacccagacggaggagaccgac
atcgagggcaggcgtatctacatctacgtgccagacccggatgtagccttcgtgcctctg
ggaatgacagattatttagtcatcgtggaggatgatgattctgccatcataccttgtcgc
acgactgatcctgagactccggtcaccttgcgcagcaatgacggggtggtgcacgcctcc
tatgacagcagacagggcttcaatgggaccttcagcgttgggccctatatctgtgaagcc
accgtcaggggaaagaagttccagaccatcccatttaatgtttatgctttaaaagcaacg
tcagaacttgatctagaaatggaagctcttaaaactgtgtataagtcaggggagacgatt
gtggtcacctgcgccgtctttaacaacgaggtggtcgaccttcagtggacttaccctgga
gaagtgaaaggcaaaggcatcaccatgctggaggaaatcaaggtcccgtccatcaaattg
gtgtatactctgagggtccccgaggccacggtgaaagatagtggagattatgaatgtgct
gcccgccaggccaccaaggaggtcaaagagatgaagaaagtcaccatttctgtccatgag
aaagggttcattgaaatcaaacccaacttcagcccgttggaagctgtcgacctgcatgaa
gtcaaacatttcgtggtggacgtgcaggcctacccccctcccaggatatcctggctgaag
gacaacctgactctgattgaaaatctcacggagatcaccacggacatagaaaagattcag
gaaataaggtatcggagcaaattaaagctgatccgtgctaaggaggaagacagtggccat
tacacgatcgtcgttcaaaatgaagatgacgtgaagagctatactttcgaactcctaact
caagttccctcatctattctggacttggtggacgaccaccacggctccacggggggacag
accgtgagatgcaccgccgaagggacgcctcttcctgatatcgagtggatgatttgcaag
gatattaagaagtgtaataatgaaacttcatgggcgattttggccaacaatatctcaaac
atcatcacggaggtccacccccgagacaggagcactgtggagggccgagtgacgttcacc
agagtggaggagaccatcgccgttcgatgtctggccaagaatctccttggggccgagagc
cgcgagctcaagctggtggctcccacgctgcgctctgagctcacggtggctgctgccgtc
ctcgtgctgctggtgattgtcatcatctccctcatcgtcctggtcgtcatttggaaacag
aaaccgaggtatgaaattcgctggagggtcattgaatccatcagcccggatggacatgaa
tatatttatgtggacccgatgcagctgccttatgactcgagatgggagtttccaagagat
ggactagtgcttggtcgtatcctgggatctggcgcgtttgggaaagtggttgaaggaact
gcctatggattaagccgctcccagcctgtcatgaaggtagcagtgaagatgctgaaaccc
acagccagatccagtgagaaacaggctcttatgtcggaactgaagataatgactcacctg
gggccgcatttaaacattgtgaacttgctgggagcctgtaccaagtcaggccctatttac
atcatcactgagtactgcttctatggggatttggtcaactatttgcataagaatagggat
agcttcctgagccgccacccggagaagccaaagaaagagctggacatttttggattgaac
cctgccgacgacagcacacggagttacgtcattttatcttttgaaaacaacggtgactac
atggacatgaagcaagctgacgccacccagtacgtccccatgctggaaaggaaagaggct
gccaagtactcagacatccagagatcgctgtatgatcgcccggcctcgtctaagaagaag
tctgtgttagactcagaagtcaaaaacctcctttcggatgataactcagaaggccttact
ttgttggatttgttgagctttacctatcaagttgcacgaggaatggaatttttggcttcg
aaaaattgtgtccaccgggacctggctgctcgaaacgtcctcctggcgcaagggaaaatc
gtgaagatctgtgacttcggcctggccagagacatcatgcacgattcgaactacgtgtcg
aaaggcagtacctttctccctgtgaagtggatggcccctgagagcatcttcgacaacctc
tacaccacactgagtgacgtctggtcttacggcattctgctctgggagatcttttccctc
ggcggcacaccctaccccggcatgatggtggattctactttctacaataagattaagagt
gggtaccggatggccaagcctgaccacgccaccagtgaagtctacgagatcatggtgaaa
tgctggcacagtgagccggagaagagaccctccttctaccacctgagtgagattgtggag
aacctgctgcccggacagtataagaagagttacgaaaagattcacctggacttcctgaag
agcgaccaccccgccgtggcgcgcatgcgcgtggacgccgacaacgcctacattggcgtc
acctacaaaaacgaggaagacaagctgaaggactgggagggcagcctggacgagcagagg
ctgagcgcggacagcggctacatcatccccctgcccgacatcgaccctgtccctgaggag
gaagacctgggcaagaggaacagacacagctcgcagacctcagaagagagtgctatcgag
acaggttcgagcagctccaccttcatcaagagagaggacgagaccatcgaggacatcgac
atgatggacgacattggcatagactcctcagacctggtagaggacagcttcctgtga

KEGG   Ursus maritimus (polar bear): 103674660
Entry
103674660         CDS       T03271                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04520  Adherens junction
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103674660 (EGFR)
   04012 ErbB signaling pathway
    103674660 (EGFR)
   04014 Ras signaling pathway
    103674660 (EGFR)
   04015 Rap1 signaling pathway
    103674660 (EGFR)
   04630 JAK-STAT signaling pathway
    103674660 (EGFR)
   04066 HIF-1 signaling pathway
    103674660 (EGFR)
   04068 FoxO signaling pathway
    103674660 (EGFR)
   04020 Calcium signaling pathway
    103674660 (EGFR)
   04072 Phospholipase D signaling pathway
    103674660 (EGFR)
   04151 PI3K-Akt signaling pathway
    103674660 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103674660 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103674660 (EGFR)
   04520 Adherens junction
    103674660 (EGFR)
   04540 Gap junction
    103674660 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103674660 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103674660 (EGFR)
   04915 Estrogen signaling pathway
    103674660 (EGFR)
   04921 Oxytocin signaling pathway
    103674660 (EGFR)
   04926 Relaxin signaling pathway
    103674660 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    103674660 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674660 (EGFR)
   05206 MicroRNAs in cancer
    103674660 (EGFR)
   05205 Proteoglycans in cancer
    103674660 (EGFR)
   05230 Central carbon metabolism in cancer
    103674660 (EGFR)
   05231 Choline metabolism in cancer
    103674660 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103674660 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103674660 (EGFR)
   05212 Pancreatic cancer
    103674660 (EGFR)
   05225 Hepatocellular carcinoma
    103674660 (EGFR)
   05226 Gastric cancer
    103674660 (EGFR)
   05214 Glioma
    103674660 (EGFR)
   05218 Melanoma
    103674660 (EGFR)
   05219 Bladder cancer
    103674660 (EGFR)
   05215 Prostate cancer
    103674660 (EGFR)
   05213 Endometrial cancer
    103674660 (EGFR)
   05224 Breast cancer
    103674660 (EGFR)
   05223 Non-small cell lung cancer
    103674660 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103674660 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103674660 (EGFR)
   05171 Coronavirus disease - COVID-19
    103674660 (EGFR)
   05163 Human cytomegalovirus infection
    103674660 (EGFR)
   05165 Human papillomavirus infection
    103674660 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103674660 (EGFR)
   01522 Endocrine resistance
    103674660 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103674660 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103674660 (EGFR)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103674660 (EGFR)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103674660 (EGFR)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103674660 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   103674660 (EGFR)
  Exosomal proteins of bladder cancer cells
   103674660 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Pkinase_fungal Borrelia_P83
Other DBs
NCBI-GeneID: 103674660
NCBI-ProteinID: XP_008701798
UniProt: A0A384D413
LinkDB
Position
Un
AA seq 1212 aa
MHAKGFGNVGPEGSHSRPPTVFSSPVLYCTESICQGTSNRLTQLGTFEDHFLSLQRMFNN
CEVVLGNLEITYMQKNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQVIRGNVLYENTH
ALSVLSNYGTNKTGLRELPLRNLHEILQGAVRFSNNPVLCSVETIQWRDIVDGDFVSNMS
MDFQNQAGSCQKCDPGCPNGSCWGPGKENCQKLTKVICAQQCSGRCRGRSPSDCRHNQCA
AGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPR
NYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIK
HFKNCTSISGDLHILPVAFRGDSFTRTLPLDPKELDILKTVKEITGFLLIQAWPENRTDL
HAFENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNQKLCYANTINW
KKLFGTSSQKTKIINNKDEKGCKAIGHVCHPLCSSEGCWGPEPKDCVSCRNVSRGKECVE
KCNVLQGEPREFVENSECIQCHPECLPQAMNVTCTGRGPDSCVKCAHYIDGPHCVKTCPA
GIMGENNTLVWKFADANRVCHLCHSNCTYGCAGPGLEGCATNGPKIPSIATGIVGGLLLV
VVVALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKV
LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRL
LGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYCADWCLQDALPQGMNYLEDRRLVH
RDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQS
DVWSYGVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDA
DSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADE
YLIPQQGFFHSPSTSRTPLLSSLSATSNNSAVACIDRNGSCPLKEDSLLQRYSSDPTGTL
TEDNIDDTFLPAPEYINQSVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAVGNPE
YLNTHPTCVSSVLDGPGLWAQKGNHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENADYL
RVAPPSSEFIGA
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgcatgccaagggctttgggaatgttggacccgagggctcgcactctcgcccacccact
gtcttcagctcacctgttctctattgcacagagtcaatttgccagggcacaagtaaccgg
ctcacccagttgggcactttcgaagaccactttctgagccttcagaggatgttcaacaac
tgtgaggtggtcctcgggaatttggaaataacctacatgcaaaagaattatgacctttcc
ttcttgaagaccatccaggaagtcgccggctatgtactcattgccctcaacacagtggag
aagattcctttggaaaaccttcaggtcatccgaggaaacgtgctctatgagaacacccat
gccttatccgtcttatccaactacggcacaaataaaaccggactgcgggaacttcccctg
agaaacttacacgaaatcctacaaggcgctgtgcgcttcagcaacaaccctgtgctctgc
agcgtggaaaccatccagtggcgggatatcgttgacggcgactttgtgagcaatatgtcg
atggacttccagaaccaagcgggcagttgccaaaagtgtgatccaggctgtcccaatgga
agctgctggggtccgggaaaggagaattgccagaaattgaccaaagtcatctgtgcccag
cagtgctcagggcgctgccgcggccggtcccccagcgactgccgccacaaccagtgtgcc
gccggctgcacggggccccgcgagagcgactgcctggtctgccgcaagttccgggacgaa
gccacgtgcaaggacacctgcccgcccctcatgctgtacaaccccaccacctaccagatg
gatgtcaaccccgaggggaagtacagttttggtgccacctgcgtgaagaaatgcccccgt
aactacgtggtgacagaccacggttcgtgtgtccgtgcctgcagctccgacagctacgag
gtggaggaagacggcgtccgcaaatgtaaaaagtgtgaggggccttgccgcaaagtttgt
aatggaataggaattggtgaatttaaagacacactttccattaatgctacaaatattaaa
cacttcaaaaattgcacctcaatcagtggagatcttcatatcctgccggtagcatttaga
ggtgactccttcacacgtactctacctctggatccaaaggaactggatattctaaaaact
gtaaaggaaataacagggtttttgctgattcaggcctggcccgaaaacaggactgacctc
catgctttcgagaacctagaaatcatacgtggaagaacaaagcaacatggtcagttttct
cttgcggtcgtcggcctggacataacatccttgggattacgctccctcaaggagataagt
gatggagacgtgatcatctcaggaaaccaaaaattgtgttatgcaaatacaataaactgg
aaaaaactatttgggacttcaagtcagaaaaccaaaatcataaacaacaaagatgaaaaa
ggctgcaaggccataggccacgtctgccatccattatgttcatccgagggctgctggggc
ccagagccgaaagactgcgtgtcctgccgcaacgtcagccggggcaaggaatgtgtggag
aagtgcaatgttctgcagggggagccaagggagtttgtggagaattccgagtgcatacag
tgccatccggaatgcctgccccaagccatgaatgtaacctgcacaggacggggaccggac
agctgcgtcaagtgtgctcactacatcgatggccctcactgcgtcaagacctgcccggct
ggcatcatgggcgagaacaataccctggtctggaagttcgcggatgccaatcgcgtgtgc
cacctgtgccattccaactgtacctacggctgtgctgggccaggtcttgaaggctgtgcg
acaaacgggcccaagatcccatccattgccaccgggatcgtgggcggcctcctcctggtg
gtggtggtggcccttggggtgggcctgttcttgcgccggcggcacatcgtccggaagcgc
acgcttcgtagactgctgcaggaaagagagcttgttgagcctcttacacccagcggagaa
gctcccaaccaagctctcttgaggatcttaaaggaaacagaattcaaaaagatcaaggtg
ctgggctctggagcattcggcacggtgtacaagggactctggatcccagaaggcgagaag
gttaaaattcccgtggccatcaaggaattaagagaagccacatctccaaaagccaacaag
gaaattcttgatgaagcctacgtgatggccagtgtggacaatcctcacgtgtgccgtctc
ctgggcatctgcctgacctccacggtccagctcatcacacagctcatgcccttcggctgc
ctcctggactatgtccgcgagcacaaggacaacattggctcccagtactgtgcagattgg
tgcctgcaggacgctctcccacagggcatgaactacctggaagaccggcgcttggtgcac
cgtgacctggcagccagaaatgtcctggtgaagaccccacagcacgtcaagatcacagat
tttgggctggccaaactgcttggtgctgaggagaaagaataccacgcagaaggaggcaaa
gtacctatcaagtggatggccttggagtcaattttacaccgaatttatacccaccaaagt
gatgtgtggagctatggagtcactgtttgggagttgatgacctttgggtccaagccttat
gacggtatccccgcaagtgagatctcaaccatcctggagaaaggagagcgcctcccacag
ccgcccatatgcaccatcgatgtctacatgatcatggtcaagtgctggatgatagatgcg
gacagtcgcccaaaattccgtgaattgatcattgagttctccaaaatggcccgtgacccc
cagcgctaccttgtcatccagggagacgagaggatgcatttgccaagccctacagactcc
aacttttaccgcgccctgatggacgaagaggacatggaggacgtcgtggacgccgacgag
tacctcatcccccaacagggcttcttccacagtccctccacatcccggacccccctcctg
agttccctgagtgccaccagcaacaattccgccgtggcttgcattgacagaaatgggagc
tgtcccctcaaagaagacagcctcctgcaacggtacagctcggaccccactggcaccttg
accgaggacaacatagatgacaccttcctcccagcacctgaatacataaaccagtccgtt
cccaaaaggcctgcgggttctgtccagaaccccgtctatcacaatcagcctctaaatcca
gctcctggcagagaccctcactaccagaatccccacagcaacgcagtgggcaaccccgag
tatctcaacacacaccctacctgcgtcagcagtgtgctcgacggccccggcctctgggcc
cagaaaggcaaccaccagatcagcctggacaacccggactaccagcaggacttctttccc
aaggaagccaagtcaaacggcatctttaagggccccgccgctgaaaatgcagactacctg
agggtagcgcccccaagcagtgagtttattggagcatga

KEGG   Ursus maritimus (polar bear): 103676585
Entry
103676585         CDS       T03271                                 

Gene name
MET
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04360  Axon guidance
umr04510  Focal adhesion
umr04520  Adherens junction
umr05100  Bacterial invasion of epithelial cells
umr05144  Malaria
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05211  Renal cell carcinoma
umr05218  Melanoma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676585 (MET)
   04014 Ras signaling pathway
    103676585 (MET)
   04015 Rap1 signaling pathway
    103676585 (MET)
   04020 Calcium signaling pathway
    103676585 (MET)
   04151 PI3K-Akt signaling pathway
    103676585 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676585 (MET)
   04520 Adherens junction
    103676585 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103676585 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676585 (MET)
   05202 Transcriptional misregulation in cancer
    103676585 (MET)
   05206 MicroRNAs in cancer
    103676585 (MET)
   05205 Proteoglycans in cancer
    103676585 (MET)
   05230 Central carbon metabolism in cancer
    103676585 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103676585 (MET)
   05226 Gastric cancer
    103676585 (MET)
   05218 Melanoma
    103676585 (MET)
   05211 Renal cell carcinoma
    103676585 (MET)
   05223 Non-small cell lung cancer
    103676585 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103676585 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    103676585 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676585 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103676585 (MET)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103676585 (MET)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  MET family
   103676585 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like Linker_histone Ninjurin PepSY_TM
Other DBs
NCBI-GeneID: 103676585
NCBI-ProteinID: XP_008704007
UniProt: A0A384DAD6
LinkDB
Position
Un
AA seq 1382 aa
MKAPAVIAPGILVLLFTLVQKSYGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSHKANLSGGVWEDNINMAL
VIDTYYDDQLISCGSVHRGTCQRHVLPPSNTADIQSEVHCMYSPQADEERGQCPDCVVSA
LGTKVLISEKDRFINFFVGNTINSSYHPDHLLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFARSKPDSTEPMNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSSTPHVNF
RLDSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCG
WCHDKCVQLEECPTGTWTQEICLPTIYEVSPTSAPLEGGTMLTVCGWDFGFRRNNKFDLK
KTKVLLGNDSCTLTLSESTTNMLKCTVGPAVNEHFNISIIIANGRGTAQYSAFSYVDPII
TSISPSYGPKTGGTLLTLTGKHLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTE
FPIKLKIDLANREMNSFSYQEDPIVYAIHPTKSFISGGSTITAVGKNLHSVSVLRMVISV
LEARRNFTVACRHRSNSEIICCTTPSLQQLNLELPLKTKAFFMLDGIHSKNFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCETIYSDSEAVLCKVPND
LLRLNNELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVISISLILLLLLGLFLWLKRRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPMLTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNIDGEG
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgattgcacctggcatccttgtacttctgtttaccttggtgcag
aagagctatggggagtgcaaagaggcactagtaaagtctgagatgaatgtgaacatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaatgttgttttacacaagcat
catatttacctcggtgcagttaactatatttacgttttaaatgacaaagaccttcagaaa
gttgctgagtacaagactgggcccgtgctggaacacccagattgtttcccatgtcaggac
tgcagccacaaagccaatttatcaggtggcgtttgggaagataacatcaacatggctcta
gttattgacacctactatgatgaccaactcattagctgtggcagtgtccacagagggacc
tgccagcgacatgtccttccacccagcaatactgctgatatacagtcggaagttcattgc
atgtactctccacaggcagacgaagagcgcggccagtgccctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgatatctgaaaaggatcggttcatcaacttcttcgtgggtaac
accataaattcctcgtaccatccagatcatttattgcattcgatatcagtgagaaggcta
aaggaaacgcaagatggtttcaagtttttgacagaccaatcttatattgatgttctacct
gagttcagagattcctaccctattaaatatgtccacgcctttgaaagcaatcattttatt
tactttttgacagtccaacgagaaactctagatgctcagacttttcacacaagaataatc
aggttctgttctgtagactctggattgcattcctacatggaaatgcctctggagtgtatt
ctcacggaaaaaagaagaaagagatccacaagggaggaagtatttaatattctccaagct
gcatatgtcagtaagcctggggcccaccttgctaagcaaataggtgccaacctgaatgat
gacattctctacggagtgtttgcacgaagcaaaccagattctactgaacccatgaatcgt
tctgccgtctgtgcattccctatcaaatatgtcaacgaattcttcaacaagatcgtcaac
aaaaacaatgtgagatgtcttcaacatttttatggacccaaccacgaacactgctttaac
aggacacttttgagaaattcatcaggctgtgaagtgcgcagtgacgaatatcgaacggag
tttaccacagctttgcagcgtgttgacttattcatgggccaattcaaccaagtcctctta
acatctatatctaccttcattaaaggagacctcaccattgctaatcttgggacgtcagag
ggtcgtttcatgcaggttgtggtttctcgatcaggatcgtcaacccctcatgtgaatttt
cgcctggattcccaccctgtgtctccagaagcaattgtggagcacccattaaaccaaaat
ggctacacactggtcgtcactgggaagaaaatcaccaagatcccactgaatggcttaggc
tgtgaacatttccagtcctgcagtcagtgtctctccgcccctccctttgtgcagtgtggc
tggtgccatgacaaatgtgtgcaattggaggaatgccccactggaacatggactcaggag
atctgtctgcctacaatctatgaggtttccccaactagtgcacccttggaaggagggaca
atgctgaccgtatgtggctgggactttggattcaggaggaataataaatttgatttaaag
aaaaccaaagttcttcttggaaatgacagctgcaccttgaccttaagtgagagcacaaca
aatatgctgaaatgcacagttggtcctgcagtgaatgagcatttcaatatatccataatt
attgcaaatggtcgagggacagcacaatatagtgcattttcctatgtggatcctataata
acaagtatttctccaagttatggtcctaagactggcggcaccttgcttactttaactgga
aagcacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtacttta
aaaagtgtgtcagatagtattctcgaatgttataccccagctcaaaccactccaactgag
ttccctattaaactgaaaattgacttagccaaccgagagatgaacagcttcagttaccag
gaagaccccattgtctatgcaattcatccaaccaaatcttttattagtggtgggagcaca
ataacagctgttggaaaaaacctgcattcagttagtgtcctgaggatggtaataagtgta
ctagaagcaagaaggaactttacagtggcatgtcgacatcgctctaattcagagataatc
tgctgtacaactccttcactgcaacagctgaatctggaactccctctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaaaactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaa
attaagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagactatatactcagattctgaagccgttttatgcaaggtccccaatgac
ctgctgagattgaacaacgagctaaatatagagtggaagcaagcagtttcttcaaccgtc
cttggaaaagtaattgttcaaccagatcagaacttcacaggattgattgttggtgttatc
tcaatatcattaatactcttattattactcgggcttttcctgtggctgaaaaggagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatgga
tcatgcagacaagttcagtatcctctgacagacctgtcccccatgcttaccagtggggac
tctgatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaggcagtccagcacgtagtgattgggccgagtagcctaattgtgcat
ttcaatgaagtcataggaagaggacattttgggtgcgtataccatgggactttgctggac
aatgatgacaagaaaattcactgtgctgtgaaatctttgaatcgaatcactgacatagga
gaagtttcccagtttctgaccgagggaatcatcatgaaagattttagtcatccaaatgtt
ctctcactcttgggaatctgccttcgaagtgaggggtctccgctggtagtcctaccatac
atgaaacatggagatcttcgaaatttcattaggaatgagactcataacccaactgtaaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaag
gttgctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaac
aaaacaggtgccaagctgcccgtgaagtggatggctttagaaagtctgcaaactcagaag
tttaccaccaagtcagatgtgtggtcctttggtgtgctcctctgggaactgatgacaaga
ggagcaccaccttatcctgacgtcaacacctttgatataacagtttacttgttgcaaggc
agaaggctcctacaacccgaatactgcccagatcccttatatgaagtgatgctcaaatgc
tggcaccctaaagctgaactgcgcccatctttttctgaactggtctccaggatatcagca
atattctctacttttattggggagcactatgtccatgtgaacgctacttatgtgaatgtc
aaatgtgtggctccatacccttctctgctgtcatcacaagataacattgacggcgagggg
gacacatga

DBGET integrated database retrieval system