Ursus maritimus (polar bear): 103660368 Help Entry 103660368         CDS       T03271                                  Gene name TP53 Definition (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr01524   Platinum drug resistance umr04010   MAPK signaling pathway umr04071   Sphingolipid signaling pathway umr04110   Cell cycle umr04115   p53 signaling pathway umr04137   Mitophagy - animal umr04151   PI3K-Akt signaling pathway umr04210   Apoptosis umr04211   Longevity regulating pathway umr04216   Ferroptosis umr04218   Cellular senescence umr04310   Wnt signaling pathway umr04722   Neurotrophin signaling pathway umr04919   Thyroid hormone signaling pathway umr05012   Parkinson disease umr05014   Amyotrophic lateral sclerosis umr05016   Huntington disease umr05160   Hepatitis C umr05161   Hepatitis B umr05162   Measles umr05163   Human cytomegalovirus infection umr05165   Human papillomavirus infection umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05168   Herpes simplex virus 1 infection umr05169   Epstein-Barr virus infection umr05200   Pathways in cancer umr05202   Transcriptional misregulation in cancer umr05203   Viral carcinogenesis umr05205   Proteoglycans in cancer umr05206   MicroRNAs in cancer umr05210   Colorectal cancer umr05212   Pancreatic cancer umr05213   Endometrial cancer umr05214   Glioma umr05215   Prostate cancer umr05216   Thyroid cancer umr05217   Basal cell carcinoma umr05218   Melanoma umr05219   Bladder cancer umr05220   Chronic myeloid leukemia umr05222   Small cell lung cancer umr05223   Non-small cell lung cancer umr05224   Breast cancer umr05225   Hepatocellular carcinoma umr05226   Gastric cancer umr05230   Central carbon metabolism in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103660368 (TP53)    04310 Wnt signaling pathway     103660368 (TP53)    04071 Sphingolipid signaling pathway     103660368 (TP53)    04151 PI3K-Akt signaling pathway     103660368 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103660368 (TP53)   09143 Cell growth and death    04110 Cell cycle     103660368 (TP53)    04210 Apoptosis     103660368 (TP53)    04216 Ferroptosis     103660368 (TP53)    04115 p53 signaling pathway     103660368 (TP53)    04218 Cellular senescence     103660368 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     103660368 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     103660368 (TP53)   09149 Aging    04211 Longevity regulating pathway     103660368 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103660368 (TP53)    05202 Transcriptional misregulation in cancer     103660368 (TP53)    05206 MicroRNAs in cancer     103660368 (TP53)    05205 Proteoglycans in cancer     103660368 (TP53)    05203 Viral carcinogenesis     103660368 (TP53)    05230 Central carbon metabolism in cancer     103660368 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     103660368 (TP53)    05212 Pancreatic cancer     103660368 (TP53)    05225 Hepatocellular carcinoma     103660368 (TP53)    05226 Gastric cancer     103660368 (TP53)    05214 Glioma     103660368 (TP53)    05216 Thyroid cancer     103660368 (TP53)    05220 Chronic myeloid leukemia     103660368 (TP53)    05217 Basal cell carcinoma     103660368 (TP53)    05218 Melanoma     103660368 (TP53)    05219 Bladder cancer     103660368 (TP53)    05215 Prostate cancer     103660368 (TP53)    05213 Endometrial cancer     103660368 (TP53)    05224 Breast cancer     103660368 (TP53)    05222 Small cell lung cancer     103660368 (TP53)    05223 Non-small cell lung cancer     103660368 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     103660368 (TP53)    05014 Amyotrophic lateral sclerosis     103660368 (TP53)    05016 Huntington disease     103660368 (TP53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103660368 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103660368 (TP53)    05161 Hepatitis B     103660368 (TP53)    05160 Hepatitis C     103660368 (TP53)    05162 Measles     103660368 (TP53)    05168 Herpes simplex virus 1 infection     103660368 (TP53)    05163 Human cytomegalovirus infection     103660368 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     103660368 (TP53)    05169 Epstein-Barr virus infection     103660368 (TP53)    05165 Human papillomavirus infection     103660368 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103660368 (TP53)    01522 Endocrine resistance     103660368 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:umr03000]     103660368 (TP53)    03036 Chromosome and associated proteins [BR:umr03036]     103660368 (TP53)    03400 DNA repair and recombination proteins [BR:umr03400]     103660368 (TP53) Transcription factors [BR:umr03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     103660368 (TP53) Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      103660368 (TP53) DNA repair and recombination proteins [BR:umr03400]  Eukaryotic type   Check point factors    Other check point factors     103660368 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  103660368 NCBI-ProteinID:  XP_008686194 UniProt:  A0A384BVC2 LinkDB All DBs Position Un AA seq 381 aa AA seqDB search MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPGVDELLLSEGVVNWMDEGSDDT PRMPVAPAPAAPGPAISWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL FCQLAKTCPVQLWVNSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCSDGSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL TIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGESSPEPPPGSTKRALPPST SCSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK KGQSTSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgcaggacccgcagtcggagctcaccatcgacccccctctgagccaggagacattttcc gaattgtggaatctgcttcctgaaaacaatgttctgtcttccgagctgtccccaggagtg gatgaactgctgctctcagaaggcgtcgtgaactggatggacgaaggttcagatgacact cccaggatgccagtggctcccgcccctgcggcccctggaccagccatctcctggcccctg tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtctggggttc ctgcattccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctg ttttgccagctggcaaagacctgccccgtgcagctgtgggtcaactccccgcccccaccc gacacctgtgtccgcgccatggccatttataagaagtcggagttcgtgacagaggttgtg cggcgctgtccccaccacgagcgctgctctgatggtagtgatgggctggccccgcctcag catctcatccgggtggaaggaaacttacgtgccaagtacttggacgacagaaacactttc cgacatagcgtggtggtgccctatgagcctcccgaggtcggctctgactgtaccacagtc cactataactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc accatcatcaccctggaagattccagtggtaatgttctcggacggagcagctttgaggta cgcgtctgtgcctgtcctgggagagaccggcgcacagaggaggagaatttccgtaagaag ggggagtcttcccccgagccgccccccggaagcactaagcgagcactgcctcccagcacc agctgctctcccccacaaaagaagaagccactggatggggaatatttcacccttcagatc cgtgggcgtgaacgcttcaatatgttcagggagctgaatgaggccttggagctgaaggat gccctgagtggcaaggagccaggggggagcagggctcactccagccacctgaaggctaag aaggggcagtctacctcccgccataaaaagctgatgttcaagagagagggacccgactca gactga

DBGET integrated database retrieval system