KEGG   Ursus maritimus (polar bear): 103660368
Entry
103660368         CDS       T03271                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04071  Sphingolipid signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04137  Mitophagy - animal
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04216  Ferroptosis
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04722  Neurotrophin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05016  Huntington disease
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103660368 (TP53)
   04310 Wnt signaling pathway
    103660368 (TP53)
   04071 Sphingolipid signaling pathway
    103660368 (TP53)
   04151 PI3K-Akt signaling pathway
    103660368 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103660368 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    103660368 (TP53)
   04210 Apoptosis
    103660368 (TP53)
   04216 Ferroptosis
    103660368 (TP53)
   04115 p53 signaling pathway
    103660368 (TP53)
   04218 Cellular senescence
    103660368 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103660368 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103660368 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    103660368 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103660368 (TP53)
   05202 Transcriptional misregulation in cancer
    103660368 (TP53)
   05206 MicroRNAs in cancer
    103660368 (TP53)
   05205 Proteoglycans in cancer
    103660368 (TP53)
   05203 Viral carcinogenesis
    103660368 (TP53)
   05230 Central carbon metabolism in cancer
    103660368 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103660368 (TP53)
   05212 Pancreatic cancer
    103660368 (TP53)
   05225 Hepatocellular carcinoma
    103660368 (TP53)
   05226 Gastric cancer
    103660368 (TP53)
   05214 Glioma
    103660368 (TP53)
   05216 Thyroid cancer
    103660368 (TP53)
   05220 Chronic myeloid leukemia
    103660368 (TP53)
   05217 Basal cell carcinoma
    103660368 (TP53)
   05218 Melanoma
    103660368 (TP53)
   05219 Bladder cancer
    103660368 (TP53)
   05215 Prostate cancer
    103660368 (TP53)
   05213 Endometrial cancer
    103660368 (TP53)
   05224 Breast cancer
    103660368 (TP53)
   05222 Small cell lung cancer
    103660368 (TP53)
   05223 Non-small cell lung cancer
    103660368 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103660368 (TP53)
   05014 Amyotrophic lateral sclerosis
    103660368 (TP53)
   05016 Huntington disease
    103660368 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103660368 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103660368 (TP53)
   05161 Hepatitis B
    103660368 (TP53)
   05160 Hepatitis C
    103660368 (TP53)
   05162 Measles
    103660368 (TP53)
   05168 Herpes simplex virus 1 infection
    103660368 (TP53)
   05163 Human cytomegalovirus infection
    103660368 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103660368 (TP53)
   05169 Epstein-Barr virus infection
    103660368 (TP53)
   05165 Human papillomavirus infection
    103660368 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103660368 (TP53)
   01522 Endocrine resistance
    103660368 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103660368 (TP53)
   03036 Chromosome and associated proteins [BR:umr03036]
    103660368 (TP53)
   03400 DNA repair and recombination proteins [BR:umr03400]
    103660368 (TP53)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    103660368 (TP53)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103660368 (TP53)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    103660368 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 103660368
NCBI-ProteinID: XP_008686194
UniProt: A0A384BVC2
LinkDB
Position
Un
AA seq 381 aa
MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPGVDELLLSEGVVNWMDEGSDDT
PRMPVAPAPAAPGPAISWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL
FCQLAKTCPVQLWVNSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCSDGSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL
TIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGESSPEPPPGSTKRALPPST
SCSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK
KGQSTSRHKKLMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaggacccgcagtcggagctcaccatcgacccccctctgagccaggagacattttcc
gaattgtggaatctgcttcctgaaaacaatgttctgtcttccgagctgtccccaggagtg
gatgaactgctgctctcagaaggcgtcgtgaactggatggacgaaggttcagatgacact
cccaggatgccagtggctcccgcccctgcggcccctggaccagccatctcctggcccctg
tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtctggggttc
ctgcattccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctg
ttttgccagctggcaaagacctgccccgtgcagctgtgggtcaactccccgcccccaccc
gacacctgtgtccgcgccatggccatttataagaagtcggagttcgtgacagaggttgtg
cggcgctgtccccaccacgagcgctgctctgatggtagtgatgggctggccccgcctcag
catctcatccgggtggaaggaaacttacgtgccaagtacttggacgacagaaacactttc
cgacatagcgtggtggtgccctatgagcctcccgaggtcggctctgactgtaccacagtc
cactataactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc
accatcatcaccctggaagattccagtggtaatgttctcggacggagcagctttgaggta
cgcgtctgtgcctgtcctgggagagaccggcgcacagaggaggagaatttccgtaagaag
ggggagtcttcccccgagccgccccccggaagcactaagcgagcactgcctcccagcacc
agctgctctcccccacaaaagaagaagccactggatggggaatatttcacccttcagatc
cgtgggcgtgaacgcttcaatatgttcagggagctgaatgaggccttggagctgaaggat
gccctgagtggcaaggagccaggggggagcagggctcactccagccacctgaaggctaag
aaggggcagtctacctcccgccataaaaagctgatgttcaagagagagggacccgactca
gactga

DBGET integrated database retrieval system