KEGG   Ursus maritimus (polar bear): 103666789
Entry
103666789         CDS       T03271                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04110  Cell cycle
umr04218  Cellular senescence
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05212  Pancreatic cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103666789 (E2F2)
   04218 Cellular senescence
    103666789 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666789 (E2F2)
   05206 MicroRNAs in cancer
    103666789 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103666789 (E2F2)
   05225 Hepatocellular carcinoma
    103666789 (E2F2)
   05226 Gastric cancer
    103666789 (E2F2)
   05214 Glioma
    103666789 (E2F2)
   05220 Chronic myeloid leukemia
    103666789 (E2F2)
   05218 Melanoma
    103666789 (E2F2)
   05219 Bladder cancer
    103666789 (E2F2)
   05215 Prostate cancer
    103666789 (E2F2)
   05224 Breast cancer
    103666789 (E2F2)
   05222 Small cell lung cancer
    103666789 (E2F2)
   05223 Non-small cell lung cancer
    103666789 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103666789 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103666789 (E2F2)
   05161 Hepatitis B
    103666789 (E2F2)
   05160 Hepatitis C
    103666789 (E2F2)
   05163 Human cytomegalovirus infection
    103666789 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666789 (E2F2)
   05169 Epstein-Barr virus infection
    103666789 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103666789 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103666789 (E2F2)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103666789 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA
Other DBs
NCBI-GeneID: 103666789
NCBI-ProteinID: XP_008693091
UniProt: A0A384CE25
LinkDB
Position
Un
AA seq 407 aa
PGLSSPQLCPATTTYYTSLYPQTVPPTAAPGTCLDATPHGPEGQAERCVPAGRLPAKRKL
DLEGIGRPAVPEFRTPKGKCVRVDGLPSPRTPKSPGEKTRYDTSLGLLTKKFIYLLSESK
DGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQ
LGQELKELMSTEQALDQLIQSCSLTFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAV
KAPPQTRLEVPDRSEENLQIYLKSTQGPIEVYLCPEEVRDPDSPAREPLPPTSPLGPSPD
STQPSSSTDPGMTEPTASPAPALTPQQIPQPPPPPLLVPLEATDSMLELPHPLLQQTEDQ
FLSLPCSSPLISFSPPLDQDDYLWGLDGGEGISDLFDSYDLGDLLIN
NT seq 1224 nt   +upstreamnt  +downstreamnt
cccggcctcagcagcccccagctctgcccggccaccaccacctactacacctcgctgtac
ccgcagactgtgcctcccactgcggcgcccggcacctgcctcgacgccaccccccacgga
ccggagggccaagctgagcgatgcgtgccggctggccggctgccggccaaaaggaagctg
gacctggaggggatcgggaggcccgcagtccctgaattccggactcccaaggggaagtgc
gttagagtggatggcctccccagccccagaacccccaagtcccccggagagaagactcgg
tacgacacgtcgctggggctgctcaccaagaaattcatttacctcttgagcgaatccaag
gatggggtcctggacctgaactgggccgccgaggtgctggacgtgcagaaacgccgcatc
tatgacatcaccaacgtgctggagggtatccagctcatccgtaagaaggccaagaacaac
atccagtgggtaggcaggggaatgtttgaagaccccacccggcctgggaagcagcagcag
ctggggcaggagctgaaggagctgatgagcacggagcaggccttggaccagctcatccag
agctgctctctgaccttcaagcacctgaccgaggacaaggccaacaagagactggcctac
gtgacttaccaggacatccgtgccgttggcaactttaaggagcagacggtgatcgcggtc
aaggcccctccccagacaagactggaggtgcccgacaggagtgaggagaacctgcagata
tatctgaaaagcacacagggacccatcgaagtctacctgtgcccagaggaagtgagggac
ccggacagccctgcccgggagcccctcccccccacctcccccctgggccccagccctgac
tccacccagcccagcagcagcactgaccctgggatgacagaacccacggcatccccagcg
ccagcgctgactccccagcagatcccgcagccgcccccgcccccgctgctggtccccctg
gaggccaccgacagcatgctggaactgccacacccacttctacagcagactgaggaccag
ttcctgtccctgccgtgcagctctcccctgatcagcttctccccgcccctggaccaggac
gactacctgtggggcttggacgggggtgagggcatcagtgacctcttcgactcctacgac
cttggggacctgctgattaattga

KEGG   Ursus maritimus (polar bear): 103674455
Entry
103674455         CDS       T03271                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04110  Cell cycle
umr04137  Mitophagy - animal
umr04218  Cellular senescence
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05212  Pancreatic cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103674455 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    103674455 (E2F1)
   04218 Cellular senescence
    103674455 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674455 (E2F1)
   05206 MicroRNAs in cancer
    103674455 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103674455 (E2F1)
   05225 Hepatocellular carcinoma
    103674455 (E2F1)
   05226 Gastric cancer
    103674455 (E2F1)
   05214 Glioma
    103674455 (E2F1)
   05220 Chronic myeloid leukemia
    103674455 (E2F1)
   05218 Melanoma
    103674455 (E2F1)
   05219 Bladder cancer
    103674455 (E2F1)
   05215 Prostate cancer
    103674455 (E2F1)
   05224 Breast cancer
    103674455 (E2F1)
   05222 Small cell lung cancer
    103674455 (E2F1)
   05223 Non-small cell lung cancer
    103674455 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103674455 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103674455 (E2F1)
   05161 Hepatitis B
    103674455 (E2F1)
   05160 Hepatitis C
    103674455 (E2F1)
   05163 Human cytomegalovirus infection
    103674455 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103674455 (E2F1)
   05169 Epstein-Barr virus infection
    103674455 (E2F1)
   05165 Human papillomavirus infection
    103674455 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103674455 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103674455 (E2F1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103674455 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 103674455
NCBI-ProteinID: XP_008701594
UniProt: A0A384D477
LinkDB
Position
Un
AA seq 373 aa
MLLLEEASVPCHLGLCDMAVPLPRVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPG
EKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKK
SKNHIQWLGSHAAVGIGGRLEGLTQDLQQLQESERQLDHLIHVCTTQLRLLSXSLTPPTL
AYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEEST
GGISPGKTPSQGTASGEEDRAVDCATTVPPTSSPPSSPAADPSQSLLSLEQEPLLSRMGG
LRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDL
FDCDFGDLTPLDF
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgttgctactggaggaggcctcagtgccttgccacttgggcctgtgtgacatggccgtg
cctctccccagggtaaagcggaggttggacctggaaactgaccatcagtacctggctgag
agcagcgggcccgcccggggcagaggccgccacccaggaaaaggtgtgaaatccccaggg
gagaagtcacgctatgagacctcgctgaatctgaccacgaaacgcttcctggagctgctg
agccgctcagctgatggcgttgttgacctgaactgggcggcagaggtgctgaaggtgcag
aagcggcgcatctacgacatcaccaacgtcctcgagggcatccagctcattgccaagaag
tccaagaaccacattcagtggctaggcagccatgcggcagtggggatcggtgggcggctt
gaaggactgacccaggacctccagcagctccaggagagtgagcggcagctggaccacctg
atccacgtctgcaccacgcaactacggctgctctctnggtccttgactccaccaaccctg
gcctacgtgacctgccaggacctccgtagcatcgcagaccctgcagagcagatggtcatg
gtgatcaaggcccctcccgagacccagctccaagctgtagactcctcagagacctttcag
atctcccttaagagcaaacaaggccccattgacgttttcctgtgccctgaggagagtaca
ggcgggatcagccctgggaagaccccgtcccaggggacagcttctggagaggaggacagg
gcagttgactgtgccaccacagtgcctccgacatcatctcccccctcgtcccctgcagcg
gatcccagccagtccctgctcagcctggagcaagaacctctcctttcccggatgggcggc
ctgcgggcccctgtggacgaggaccgcctgtccccgctggtggcggccgactcgctcctg
gaacatgtgcgggaggacttctccggcctcctccctgaggagttcatcagcctgtccccc
ccccacgaggccctcgactaccactttggccttgaggagggtgagggcatcagagacctc
ttcgactgtgactttggggaccttacccctctggatttctga

KEGG   Ursus maritimus (polar bear): 103678383
Entry
103678383         CDS       T03271                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04110  Cell cycle
umr04218  Cellular senescence
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05212  Pancreatic cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103678383 (E2F3)
   04218 Cellular senescence
    103678383 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103678383 (E2F3)
   05206 MicroRNAs in cancer
    103678383 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103678383 (E2F3)
   05225 Hepatocellular carcinoma
    103678383 (E2F3)
   05226 Gastric cancer
    103678383 (E2F3)
   05214 Glioma
    103678383 (E2F3)
   05220 Chronic myeloid leukemia
    103678383 (E2F3)
   05218 Melanoma
    103678383 (E2F3)
   05219 Bladder cancer
    103678383 (E2F3)
   05215 Prostate cancer
    103678383 (E2F3)
   05224 Breast cancer
    103678383 (E2F3)
   05222 Small cell lung cancer
    103678383 (E2F3)
   05223 Non-small cell lung cancer
    103678383 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103678383 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103678383 (E2F3)
   05161 Hepatitis B
    103678383 (E2F3)
   05160 Hepatitis C
    103678383 (E2F3)
   05163 Human cytomegalovirus infection
    103678383 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103678383 (E2F3)
   05169 Epstein-Barr virus infection
    103678383 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103678383 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103678383 (E2F3)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103678383 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 103678383
NCBI-ProteinID: XP_008705945
UniProt: A0A384DGN3
LinkDB
Position
Un
AA seq 360 aa
MAVAVAVAVAVAVCISLTNGCTFTLQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPD
SPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVL
EGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLK
LLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGP
IEVYLCPEETETHSPMKTNNQDHNGNIPKPPSKDLASTNSGHSDCSISMANLSPLASPAN
LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggccgtggccgtggccgtggccgtggctgtggccgtgtgtatctcgttgacgaacggt
tgtactttcacgttgcaggcaaagcgaaggctggagctaggagaaagcggtcatcagtac
ctctcagatggcttaaaaacccccaagggcaaaggaagagccgccctgcgaagtccagat
agtccaaaaactccaaaatctccctcagaaaaaacacggtatgacacatcacttggtctg
ctcaccaagaagttcatccagctcctgagccagtcccccgacggggtcttggatttgaac
aaggcggcggaggtgctgaaggtgcagaagaggagaatctacgacatcaccaacgtgctg
gagggcatccacctcattaagaagaagtcgaaaaacaacgtacagtggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtccaaggaagtgaccgag
ctcagccaggaggagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgctaaccgaagattcagagaatcaaaggttagcttacgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtcaaagcccctccagaaacaaga
cttgaagtgcctgacccaatagagagcctacaaatacatttggcaagtacccaagggccc
attgaggtttatttatgtccagaagagacagaaacacacagtccaatgaaaacaaacaac
caagaccacaatgggaatatcccgaaacccccttccaaagacttggcttcaaccaactca
ggacatagcgattgttcgatttctatggcaaacctttctcctttggcctccccagccaac
ctcttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaactta
ctgcctcccctgctccaagaagactatctcctaagccttggggaggaagaaggcatcagc
gatctctttgatgcttatgatttggaaaagctcccactggtggaagacttcatgtgtagt
tga

DBGET integrated database retrieval system