KEGG   Ursus maritimus (polar bear): 103667098
Entry
103667098         CDS       T03271                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 34A-like
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04934  Cushing syndrome
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05222  Small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103667098
   04068 FoxO signaling pathway
    103667098
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103667098
   04218 Cellular senescence
    103667098
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103667098
   05203 Viral carcinogenesis
    103667098
  09162 Cancer: specific types
   05226 Gastric cancer
    103667098
   05222 Small cell lung cancer
    103667098
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103667098
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103667098
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank
Other DBs
NCBI-GeneID: 103667098
NCBI-ProteinID: XP_008693428
UniProt: A0A384CEY2
LinkDB
Position
Un
AA seq 260 aa
MREEDKGMLGGGGDDAGLANAAAQGQVETVRQLLEAGADPNGVNRFGRRPIQVMMMGSTR
VAELLLLHGAEPNCADEATLTRPVHDAAREGFLDTLVVLHPGEALDRSRLTAGPGRWGTG
SAPPACKRRPGLDFPPWWSQRARVRAPSSPAAGDLPGCALELGSLSSGRLSPRPRRRGEP
RMEEVPPTPQGPRGWGSAPPTWWGARPAAPAAPAPLSVQMSRRRQAAVSFNFARFPNLEV
ELSAISFKTDIQPPEWLIRR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgcgaggaggacaagggcatgctcggtggtggcggcgacgacgcgggcctggccaac
gccgcggcgcaggggcaagtggagaccgtgcggcagctcctggaagcgggtgcggatccc
aacggagtcaaccgcttcgggaggcggccgatccaggtcatgatgatgggcagcacccgc
gtggccgagctgctgctgctccacggcgcggagcccaactgtgccgacgaagccaccctc
acccgacctgtgcacgacgcggcccgggagggcttcctggacacgctcgtggtgctgcac
cccggcgaggctctagatcgatcgcgactgactgcaggccccggacgttggggcaccggg
tcagcgccgcccgcctgcaagcggcgtcctgggctcgacttcccgccttggtggagccag
cgagcccgcgtccgagctccatccagcccggcagccggggacctgccaggctgcgctctg
gaactcggctccttgtcctcaggccgcctctccccgcgccctcggcgacgcggggagccg
agaatggaagaggtgcccccgaccccgcagggaccccggggttggggttcggctccacct
acctggtggggcgcccggcccgccgctcccgcggcgccagcgccactcagtgtccagatg
tcgcgtcggcggcaagcagcggtttcctttaatttcgctcgtttcccaaatctagaagtg
gagcttagcgccatttctttcaaaaccgacatccagcctcctgaatggctgatacggcgc
tga

KEGG   Ursus maritimus (polar bear): 103679831
Entry
103679831         CDS       T03271                                 

Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor B-like
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04934  Cushing syndrome
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05222  Small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103679831
   04068 FoxO signaling pathway
    103679831
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103679831
   04218 Cellular senescence
    103679831
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679831
   05203 Viral carcinogenesis
    103679831
  09162 Cancer: specific types
   05226 Gastric cancer
    103679831
   05222 Small cell lung cancer
    103679831
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103679831
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679831
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 103679831
NCBI-ProteinID: XP_008707589
UniProt: A0A384DLC7
LinkDB
Position
Un
AA seq 93 aa
PLCSLRQVMMMGSTRVAELLLLHGAEPNCADEATLTRPVHDAAREGFLDTLVVLHRAGAR
LDVRDAWGRLPVDLAEERGHRAVARYLRAAAGD
NT seq 282 nt   +upstreamnt  +downstreamnt
ccactctgctctctccggcaggtcatgatgatgggcagcacccgcgtggccgagctgctg
ctgctccacggcgcggagcccaactgtgccgacgaagccaccctcacccgacctgtgcac
gacgcggcccgggagggcttcctggacacgctcgtggtgctgcaccgcgccggggcgcgt
ctggacgtgcgcgatgcctggggccgcctgcccgtggatctggctgaggagcggggccac
cgcgctgtcgcccggtacctgcgcgcagctgcaggagactga

DBGET integrated database retrieval system