KEGG   Ursus maritimus (polar bear): 103667907
Entry
103667907         CDS       T03271                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04216  Ferroptosis
umr05200  Pathways in cancer
umr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    103667907 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103667907 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103667907 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 103667907
NCBI-ProteinID: XP_008694400
UniProt: A0A384CJ12
LinkDB
Position
Un
AA seq 650 aa
MLEEQQRGNCGWTEQAKRRAGTVSRMSTSQDQSGCSSTREPLLRCCDARRDLELAIGGVL
RAEQQIKDNLQEVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQTQQLYWL
LGQFNCLIHQLECTQNKDLANQVSVCLERLGNLTLKPEDSTVLLFEADTTALRQAITTFG
SLKTIQIPEHLIAHANSSNLGSFLEKRGYIPLPEQKSASSTTAVSLSEWLLGSKPANGRQ
APYIPSTNLQDWLTQKQTLENSQTSARACSFFSNVWGNLKGLENWLYKSQQQEVPEKPTY
QKCNSHSTTSSHSIEIEKVGDQDLLDQDEMDLSDWLVTPQESRKLEKPGNSSCETSEKLK
LLLQVFQEPYSVNDWLVKPDSCTNCRGNQPKGVEIENLGNLKCLNDHLEAKKPLSIPNLI
TEDWLVQNHQDTFKVEEVCKANEPCTSFAECVCDENCEKEALCKWLLKKEGKDKNGMPVE
PNPEPEKCIDSLSVWLCPSRKEATQQAKTSKAVAPSRIADCFQVIRNSPLSEWLITPTCK
EGCPKEVPSAEDRAGKQKLTNPVATSWCPFNTADWVLPGEKMGNLSHLSSGEDKWLLRKK
AKEVLLNSPLQEERNFPQDRYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgctggaggagcagcaaagaggcaattgtggctggactgagcaagcaaagagaagagca
ggaacggtgagcagaatgagcacctcacaggaccagagcggctgctccagtaccagagaa
ccccttttgaggtgttgtgatgcacggagggacttggagcttgctattggtggagttctc
cgggctgaacagcaaattaaagataacttgcaagaggttaaagcccagattcacagctgc
ataagccgtcacctggaatgccttcgaagccgtgaggtgtggctgtatgaacaggtagat
ctcatctatcagcttaaagaggagacgcttcagcagcagacccaacagctctactggtta
ctgggccagttcaattgtcttattcatcaactggagtgcacccaaaacaaggatctagcc
aatcaagtctctgtgtgcctggagagactgggcaatttgaccctcaaacccgaagattcg
actgtcctactgtttgaagcagacacaactgctctgcgccaggccatcaccacatttgga
tccctcaagaccatccaaattcctgagcacctgattgctcatgctaattcatcaaatctt
gggtctttcctggagaaaagaggttatatcccattgccagaacagaagtcagcatccagc
accacggctgtctctctcagcgaatggctccttggaagcaaacctgccaatggtcgtcag
gctccttacatccccagcaccaacctccaggactggctcacccaaaagcagaccttggag
aatagtcagacttctgccagagcctgcagtttcttcagtaatgtctggggcaacctaaag
ggcttagaaaactggctctacaagagtcagcaacaagaggttcctgaaaaaccaacttac
caaaagtgtaacagtcattctaccaccagttctcactctattgaaattgaaaaggttgga
gaccaggaccttcttgatcaagatgagatggacctttctgattggctggtgactcctcag
gaatcccgtaagctggagaagcctgggaatagcagctgtgaaaccagtgagaagttgaag
ctcctgttgcaggtgttccaggagccctatagtgtgaatgattggcttgtcaagcccgat
tcctgtaccaattgtcggggcaaccagcccaagggtgtggagattgaaaacctgggcaat
ctgaagtgcctgaatgaccacttagaagccaagaaacccttgtccattcccaacctgatt
actgaggattggcttgtccagaaccatcaggacacatttaaagtagaggaggtatgcaaa
gccaacgagccctgtacaagctttgcagagtgtgtgtgtgatgagaactgtgagaaggaa
gctctgtgtaaatggcttctgaagaaagaaggaaaagacaaaaatggtatgcctgtggaa
ccaaatcctgagcctgagaaatgtatagattccctgagtgtgtggctctgtccttccaga
aaagaggcaacacaacaagctaagacgtcaaaggcagtggctccttctagaattgccgat
tgcttccaagtcataaggaatagtcctttgtcagagtggctcatcacacccacatgcaaa
gaaggttgtcccaaagaagtgcctagtgctgaagacagagctggcaagcagaagcttacg
aaccccgtggccacttcctggtgtccctttaacacagctgactgggtcttgccaggagag
aaaatgggaaacctcagccatttatcctcaggagaagacaagtggctacttcgaaagaag
gccaaggaagtattacttaactcacccctacaggaggaacgtaactttccccaagaccgt
tatggcctcccagcagtttgtgacctgtttgcctgtatgcagcttaaagttgacaaagaa
aagtggttgtatcgaactcctctacagatgtga

KEGG   Ursus maritimus (polar bear): 103667987
Entry
103667987         CDS       T03271                                 

Gene name
CCDC6
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05200  Pathways in cancer
umr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103667987 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103667987 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 103667987
NCBI-ProteinID: XP_008694498
UniProt: A0A384CI27
LinkDB
Position
Un
AA seq 437 aa
MPPSPGAPDSKRVALNGGRQLRTSHQRQRGNRGCCHFYLEPASQHQPWGPGEDAAALGRK
LAARQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKA
ELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRL
WKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLR
AAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYF
NEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPG
LHVQHMGASHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPAAPSAA
TAQPAPSQHPAHPSSQP
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcccccgagtccaggcgctcctgacagcaagcgtgtggcactgaacggtggcaggcag
ctccggacgtcacaccagcgtcagagaggcaatcgtggctgctgccatttctatctggag
cctgcgtcccagcaccagccctggggtcctggcgaggacgctgctgccttgggaagaaaa
ctggctgctcgacaagccagggctgagcaagaggaagaattcatcagtaacactttattc
aagaaaatccaggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaggaa
gaagagttcctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagct
gaactggaacagcatctcgaacaggagcaggaattccaggtcaacaaactgatgaagaaa
attaaaaaactggagaatgataccatttctaagcagcttacattagaacagttgagacga
gagaagatcgaccttgaaaatactttggaacaagaacaagaagcgctagttaatcgtctc
tggaaaaggatggacaaacttgaagctgaaaagcgaatcctgcaggagaaattagaccag
ccggtctctgctcccccgtcgcctagagacatctccatggagatagactccccagaaaac
atgatgcgccacatcaggtttttaaagaatgaagtggagaggctgaagaagcagctgaga
gccgctcagttacagcattcggagaaaatggcgcagtacctggaggaggagcgccacatg
cgggaggagaacctgcggctgcagcgaaagctgcagcgagagatggagagaagggaagcc
ctgtgtcggcagctgtccgagagcgagtccagcctggaaatggacgacgaaaggtatttt
aacgagatgtctgcacaaggattaagacctcgcactgtgtccagcccgatcccttacaca
ccttctccaagttcaagcaggcctatatcaccgggtctatcatatgcaagtcacacagtt
ggtttcacgccaccaacttcactgactagagccggaatgtcttactacaattccccaggt
ctgcatgtgcagcacatgggagcctcccatggcatcacaaggccttcaccacggagaagc
aacagtcctgacaaattcaaacggcccacgccacctccgtctcccaacacacagaccccg
gtccagccccctccgcctccacccccaccacccatgcagcctgcagccccctcggcagcc
accgcgcagcccgccccttcgcagcatccggcgcacccctcctcccagccttaa

KEGG   Ursus maritimus (polar bear): 103668071
Entry
103668071         CDS       T03271                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret-like
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr05200  Pathways in cancer
umr05216  Thyroid cancer
umr05223  Non-small cell lung cancer
umr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103668071
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668071
   05230 Central carbon metabolism in cancer
    103668071
  09162 Cancer: specific types
   05216 Thyroid cancer
    103668071
   05223 Non-small cell lung cancer
    103668071
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103668071
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103668071
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  RET family
   103668071
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin RIO1 Pkinase_fungal
Other DBs
NCBI-GeneID: 103668071
NCBI-ProteinID: XP_008694567
UniProt: A0A384CID3
LinkDB
Position
Un
AA seq 1087 aa
MAEAGQDRGELAQGASVTAQGFVGEQSPVPADRGYLAPLGLYFSRDAYWEKLYVDQPAGM
PLLYVHALRDVPEEVPSFRLGQHLYGIAYRARLHENDWIRIEEDTGLLYLNRSLDHSAWE
KLSIRNGGFPVLTIYLQVFLSSASLREGECQWPGCARVYFSFINTSFPACSFLKPRELCF
PETGVSFRIRENRPPGTFHQFRLLPVQFLCPNISVSYRLLEGENLPFRCAPDSLEVSTRW
ALDRELREKYELVAACTVRVGARKEEVVMVPFPVTVYDEDDSAPTFLGGFDTASAVVEFK
RKEGTVVATIRVFDADVVPASGELLRRYTSTLLPGEAWALQTFRVEHSPNETLVQANGSF
VRATVHDYRLVLNRSLPISESRSLQLAVLVNDSDFQGPGEGVLLLHFNVTVLPVSLHLPS
AYSFTVSKRARRFAQIGKVCVDNCQEFSGIHVQYKLQLSSTNCSVLGVVTSAEDTTGTLF
VNDTEALQRLDCSQLQYTVVAADRPTRRQTQAPLVVTVEGTYVAEEPGCPLSCAVSKRRP
ECEECGGLGSLTGRCEWRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESRNVNICPQDCL
RGGSIIGGHEPGDRWGIKAGFGICNCFPEEKKCFCEPEDSQDPLCDELCRTVIAAAVLFS
FIISMLLSTFCIHRYHKNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVS
VDAFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENAS
PSELRDLLSEFNLLKQVNHPHVIKLYGACSQDGPLFLIVEYAKYGSLRGFLRESRKAGPG
YVGSGGSRSSSYLDNPEERALTMGDLISFAWQISRGMRYLAEMKLVHRDLAARNVLVAEG
RKMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIV
TLGGNPYPGIPPERLFNLLKTGYRMERPDNCSEEMYGLMLQCWKQEPDKRPVFADISKDL
EKMMVKNRDYLDLAASTPSDSLLYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGRI
SHAFTRF
NT seq 3264 nt   +upstreamnt  +downstreamnt
atggccgaggctggccaggaccgcggagagctggcgcagggagcctcagtcactgctcag
ggcttcgtgggggaacaaagccctgtcccagcagacaggggctacctcgctccactggga
ctctacttctccagggatgcttactgggagaaactgtacgtggaccagccggctggcatg
cccctgctctacgtccatgctctgcgggacgtccccgaggaggtgcccagcttccgcctg
ggccagcatctctacggcatcgcctaccgcgcaaggctgcatgagaacgactggatccgc
atcgaggaggacacaggccttctctaccttaaccggagcctggatcacagcgcctgggag
aagctcagcatccgcaatggcggcttccctgtgctcaccatctacctccaggtcttcctg
tcgtctgcgtccctgcgtgagggcgagtgccagtggccaggctgtgcccgtgtgtacttc
tcctttatcaacacctccttcccagcttgcagttttctcaaaccccgggagctctgcttt
cctgagacaggtgtctccttccgcatcagagagaacaggcctcctggcaccttccaccaa
ttccggctgctgcctgtgcagtttctctgccccaacatcagtgtgtcctacaggctccta
gaaggtgagaatctgcccttccgttgcgccccggacagcctggaggtgagcacacgctgg
gccttggaccgcgagctgcgggagaagtatgagctggtggccgcgtgcacggtgcgcgtc
ggcgcgcgcaaggaggaggtggtgatggtgcccttccctgtgaccgtgtacgatgaggac
gactcggcgcccaccttcctcgggggcttcgacaccgccagcgctgtggtggagttcaag
aggaaggagggcactgtggtggccacaatacgtgtcttcgacgcagatgtggtgccagca
tctggggagctcctgaggagatacacaagcacactactccctggggaggcctgggccctc
cagacattccgtgtcgagcactcacccaacgagaccttggtccaggccaatggcagcttt
gtgcgggcaactgtgcacgactacaggctggttctcaaccggagcctccccatctcggag
agccgctccctgcagctggccgtgctggtcaatgactcggacttccagggccccggggag
ggtgtcctcctcctccacttcaacgtgaccgtgctgcctgtcagcctgcacttacccagc
gcctactccttcactgtgagcaagcgggcccgccgctttgcccagattgggaaagtctgt
gtggacaactgccaggagttcagcggcatccacgtgcagtacaagctgcagctctccagc
accaactgcagtgtcctgggggtggtcacctcagccgaggacaccacggggaccctgttc
gtgaatgacacggaagccctgcagcggctcgattgttctcaactccagtacacggtggtg
gctgccgaccggccaacccgcaggcagacccaggccccgctggtcgtcaccgtggagggg
acgtatgtggctgaggagccaggctgccctctgtcctgtgcagtcagcaagaggcggcct
gagtgtgaggagtgcggcggcctgggctctctgacgggcaggtgcgagtggagacaggga
gatggcaaagggatcacgaggaacttctccacctgctcccccagcatcaagacctgcccc
gatggccactgtgatgctgtggagagcagaaatgtcaacatctgcccccaggactgcctc
aggggcggcagcatcattggtgggcacgagccaggggaccgctggggaataaaagctggc
ttcggtatctgcaactgtttccctgaagagaagaagtgcttctgtgagcctgaagacagc
caggacccactgtgtgacgagctctgccgcacagtgatcgcggcggccgtgctcttctcc
ttcatcatctccatgctgctctccaccttctgcatccaccgctaccacaagaacgcccac
aagccgcccatcgcctccgccgagatgaccttccgccggccggcccaggccttcccagtc
agttactcctcgtcgggtgcccgccggccctccctggactccatggagaaccaggtctct
gtggatgccttcaagatcccggaggatccaaagtgggaattccctcggaagaacttggtt
cttggaaaaactctgggagaaggtgaatttggaaaagtggttaaggcaaccgccttccgg
cttaaaggcaaagcagggtacacaaccgtggccgtgaagatgctgaaagagaacgcctcc
ccaagcgagctgcgggacctgctgtcagagttcaacctcctgaagcaggtcaaccaccca
catgtcatcaagctgtacggggcctgcagccaggatgggccactcttcctcattgtggag
tacgccaagtacggctccctgcggggattcctccgagagagccgcaaggccgggccgggc
tacgtgggcagtggaggcagccgcagctccagctacctggacaaccccgaggagcgggcc
ctgaccatgggtgacctcatctccttcgcctggcagatctctcgggggatgcggtacctg
gcggagatgaagcttgtccatcgggacttggctgccagaaatgtcctggtagctgagggg
cggaagatgaagatttcagattttggcctatcccgagatgtttatgaagaggattcctat
gtgaagaggagcaagggtcggattccagtcaaatggatggcaattgagtctcttttcgat
catatctacaccacccagagtgatgtgtggtccttcggtgtcctgctgtgggagattgtg
actctgggaggcaacccctacccgggtattcctccagagcggctcttcaaccttctgaag
acaggctaccggatggagaggcctgacaactgcagcgaggagatgtatggtctaatgctg
cagtgttggaagcaggaaccagacaagaggccggtgtttgctgacatcagcaaagacctg
gagaagatgatggttaagaacagagactacttggacttggctgcgtccaccccatctgac
tccctgctttacgacgatggcctctcagaggaggagacgcccctggtggactgtaataat
gctcccctccctcgagcccttccctccacgtggattgaaaacaaactctatggtagaatt
tcacatgcatttactagattctag

DBGET integrated database retrieval system