KEGG   Ursus maritimus (polar bear): 103668115
Entry
103668115         CDS       T03271                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04068  FoxO signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04217  Necroptosis
umr04650  Natural killer cell mediated cytotoxicity
umr04722  Neurotrophin signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr04940  Type I diabetes mellitus
umr05022  Pathways of neurodegeneration - multiple diseases
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05168  Herpes simplex virus 1 infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05320  Autoimmune thyroid disease
umr05330  Allograft rejection
umr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103668115 (FASLG)
   04014 Ras signaling pathway
    103668115 (FASLG)
   04068 FoxO signaling pathway
    103668115 (FASLG)
   04151 PI3K-Akt signaling pathway
    103668115 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103668115 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103668115 (FASLG)
   04217 Necroptosis
    103668115 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103668115 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103668115 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668115 (FASLG)
   05205 Proteoglycans in cancer
    103668115 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103668115 (FASLG)
   05330 Allograft rejection
    103668115 (FASLG)
   05332 Graft-versus-host disease
    103668115 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    103668115 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103668115 (FASLG)
   04932 Non-alcoholic fatty liver disease
    103668115 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103668115 (FASLG)
   05161 Hepatitis B
    103668115 (FASLG)
   05160 Hepatitis C
    103668115 (FASLG)
   05164 Influenza A
    103668115 (FASLG)
   05162 Measles
    103668115 (FASLG)
   05168 Herpes simplex virus 1 infection
    103668115 (FASLG)
   05163 Human cytomegalovirus infection
    103668115 (FASLG)
   05165 Human papillomavirus infection
    103668115 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103668115 (FASLG)
   05143 African trypanosomiasis
    103668115 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103668115 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103668115 (FASLG)
   04052 Cytokines and growth factors [BR:umr04052]
    103668115 (FASLG)
   04090 CD molecules [BR:umr04090]
    103668115 (FASLG)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103668115 (FASLG)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Tumor necrosis fators
   103668115 (FASLG)
CD molecules [BR:umr04090]
 Proteins
  103668115 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 103668115
NCBI-ProteinID: XP_008694607
UniProt: A0A384CIH2
LinkDB
Position
Un
AA seq 278 aa
MQQPLNYPYPQIYWVDSSAGSPWAPPGSVLPCPSSVPGRPPPPRRPPPPPPPTLPPPPPL
APLPLPPVKTRRDHNPGACLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQSHI
ASSLEKQIGQPNPPSEKRELRKVAHLTGKSNSRSIPLEWEDTYGIALVSGVKYKKGGLVI
NDTGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKIMNYCTTGQMWARSS
YLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaactacccgtacccccaaatctactgggtggacagcagtgccggc
tctccctgggcccctcccggctcagtcctcccgtgtccatcctctgtgccgggaaggcca
ccgccacccaggaggccaccgccaccaccgccaccaacactaccgccgccaccaccgctg
gctccgctgccgctgccgcctgtgaagacgcggagggaccacaacccaggcgcgtgcctc
cttgtgatgtttttcatggttctggtggccctggttggactggggctgggcatgttccag
ctctttcacctacagaaggagctggccgaactcagagagtccaccagccaaagtcatata
gcatcatctttggagaagcaaataggtcaacccaacccaccctctgaaaaaagggagctg
agaaaagtggcccatttaacaggcaagtccaactcaagatccatccctctggaatgggaa
gacacgtatggaattgcccttgtctctggggtgaagtataagaagggtggccttgtgatc
aatgatactgggttgtactttgtgtattccaaagtgtacttcaggggtcagtcctgcaac
aaccagcccctgaaccacaaggtctatatgaggaactctaagtatccccaggacctggtg
ctgatggaggggaagataatgaactactgcactactggccagatgtgggcccgcagcagc
tacctgggagcggtattcaatctcaccagtgctgaccatttatatgtcaatgtatctgaa
ctgtctctggtcagttttgaggaatctaagacattttttggcttatataagctctaa

DBGET integrated database retrieval system