KEGG   Ursus maritimus (polar bear): 103671004
Entry
103671004         CDS       T03271                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103671004 (IKBKE)
   04621 NOD-like receptor signaling pathway
    103671004 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    103671004 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    103671004 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    103671004 (IKBKE)
   04657 IL-17 signaling pathway
    103671004 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    103671004 (IKBKE)
   05160 Hepatitis C
    103671004 (IKBKE)
   05171 Coronavirus disease - COVID-19
    103671004 (IKBKE)
   05164 Influenza A
    103671004 (IKBKE)
   05162 Measles
    103671004 (IKBKE)
   05168 Herpes simplex virus 1 infection
    103671004 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103671004 (IKBKE)
   05169 Epstein-Barr virus infection
    103671004 (IKBKE)
   05165 Human papillomavirus infection
    103671004 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103671004 (IKBKE)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     103671004 (IKBKE)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103671004 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH DUF4678
Other DBs
NCBI-GeneID: 103671004
NCBI-ProteinID: XP_008697776
UniProt: A0A384CSI5
LinkDB
Position
Un
AA seq 721 aa
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTASYLRPHEVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLMGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKTFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEMMYRITTE
KPAGAIAGTQRQQNGPLEWSYSLPITCRLSTGLQTQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHVYIHAHNTIAIFLEAVYEQTQVAPQHQEYLFEGHLCV
LEPSLSAQHIAHTTSSSPLTLFSTASETPKGLAFRDPAQDIPKFFPKVDLQSDYTTSKSV
LGAGYQALWLAQTLLAGQELMLRGLDWFVXVTPRAGWMGRRTLEGVRVALLFLSSSLGTE
RVSSVSGTLEIEEVKKVTELKSRLRALAEALSRCSHRITETQSCLSNLSSELLKNRDQVH
ADRSIQKIQCCLDKMNLIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSRLAKRLLKVFQEK
CVQKYQTSLVTHGMWMREVHETRNRLRMVGCSVAAHNTEAQGVQESLSKILDRLSHQLLQ
DRAKEAQVSPPPAAPYPSPALTDLVFHMRELCDEMKLLAFDLQDNNRIIEGLNRLPSAPD
S
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgcagagcaccgccaactacctgtggcacacggacgacctgctgggccagggcgccact
gccagcgtgtacaaggcccggaacaagaaatccggggagctggttgccgtgaaggtcttc
aacacggccagctacctgcgcccgcacgaggtgcaggtgagggagttcgaggtcctgcga
aagctgaaccaccagaacatcgtcaagctcttcgcggtggaggagacagggggcagccgg
cagaaggtgctggtgatggagtactgctctagcgggagcctgctgagcgtgctcgagagc
cccgagaatgcctttgggctgcccgaggaggagtttctggtggtgctgcgctgtgtggtg
gctggcatgaaccacctgcgggagaatggcatcgtccaccgcgacatcaagcctgggaat
atcatgcgtctcatgggggaggaggggcagagcatctacaagctcacggacttcggggcc
gcccgggagctagacgatgacgagaagtttgtctctgtctatggcactgaggagtacctg
caccccgacatgtatgagcgggctgtgcttcgcaagccccagcagaagacattcggggtg
actgtggatctctggagcattggggtcaccctgtaccacgccgccactggcagcctgccc
ttcatcccttttggtgggccacgacgcaacaaggagatgatgtaccggatcaccacggag
aagccggccggcgccatcgcaggcactcagaggcagcagaatgggcccctggagtggagc
tacagcctccccatcacctgccgcctgtccacggggctgcagacccagctggtgcccatc
ctggccaacatcctggaagtggagcaggccaagtgctggggcttcgaccagttctttgca
gagaccagtgacatcctgcagcgagtcgttgtgcacgtgttctccctgtcccaggccgtc
ctgcaccacgtctacatccacgcccacaacacgatagccatctttctggaggctgtgtat
gagcagacccaggtggccccccagcaccaggagtacctcttcgagggtcacctctgcgtc
cttgagcccagcctgtcagcacaacacatcgcccacacgacctcaagcagccccctgacg
ctgttcagcacagccagtgagacccccaaggggttggccttcagggacccggctcaggac
atccccaagttcttccccaaagtggacctgcagtcagattacaccacttccaagagtgtg
ttgggcgccggctaccaggccctgtggttggcgcagaccctgctggccgggcaggagctc
atgcttcgggggctggactggtttgtgtgagtaaccccgagggctgggtggatgggcagg
cggacactggagggcgtgcgggtggccctccttttcctcagcagcagcctaggcactgag
agggtcagcagtgtgtctgggacgcttgagatagaggaggtgaagaaagtgaccgagctg
aagtccaggctgcgggctctggcagaggccctctccagatgctcccacaggatcacagag
acccagtcatgcctgagcaacctgagctctgagctgctgaagaaccgggatcaggtacat
gcggacagaagcatccagaagattcagtgttgtttggacaagatgaacctcatctacaaa
caattcaagaaatccagaatgaggccagggcttggctacaacgaggagcagattcacaag
ctggataaggtgaattttagtcgtctagccaagaggcttctgaaggtattccaggagaag
tgtgtgcagaagtaccagacatccctggtcacacacggcatgtggatgagggaggtgcac
gagaccaggaaccgtctgcgcatggtcggctgttccgtggctgcccacaacacggaagcc
cagggagtccaggagagcctcagcaagatccttgaccggttatctcaccagctccttcag
gacagagcaaaggaggctcaggtctcaccacccccggcagccccctatcccagccctgca
ctgacggacctggttttccacatgagggaactctgcgatgagatgaagctgctggccttt
gaccttcaggacaacaaccgcatcattgaagggttaaataggctcccatcggctcccgac
tcctga

DBGET integrated database retrieval system