KEGG   Ursus maritimus (polar bear): 103677947
Entry
103677947         CDS       T03271                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01523  Antifolate resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04066  HIF-1 signaling pathway
umr04071  Sphingolipid signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04218  Cellular senescence
umr04380  Osteoclast differentiation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04917  Prolactin signaling pathway
umr04920  Adipocytokine signaling pathway
umr04926  Relaxin signaling pathway
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05030  Cocaine addiction
umr05132  Salmonella infection
umr05133  Pertussis
umr05134  Legionellosis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05206  MicroRNAs in cancer
umr05212  Pancreatic cancer
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05321  Inflammatory bowel disease
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103677947 (NFKB1)
   04014 Ras signaling pathway
    103677947 (NFKB1)
   04064 NF-kappa B signaling pathway
    103677947 (NFKB1)
   04668 TNF signaling pathway
    103677947 (NFKB1)
   04066 HIF-1 signaling pathway
    103677947 (NFKB1)
   04071 Sphingolipid signaling pathway
    103677947 (NFKB1)
   04024 cAMP signaling pathway
    103677947 (NFKB1)
   04151 PI3K-Akt signaling pathway
    103677947 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103677947 (NFKB1)
   04218 Cellular senescence
    103677947 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103677947 (NFKB1)
   04620 Toll-like receptor signaling pathway
    103677947 (NFKB1)
   04621 NOD-like receptor signaling pathway
    103677947 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    103677947 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    103677947 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    103677947 (NFKB1)
   04660 T cell receptor signaling pathway
    103677947 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    103677947 (NFKB1)
   04659 Th17 cell differentiation
    103677947 (NFKB1)
   04657 IL-17 signaling pathway
    103677947 (NFKB1)
   04662 B cell receptor signaling pathway
    103677947 (NFKB1)
   04062 Chemokine signaling pathway
    103677947 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103677947 (NFKB1)
   04917 Prolactin signaling pathway
    103677947 (NFKB1)
   04926 Relaxin signaling pathway
    103677947 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103677947 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103677947 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    103677947 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103677947 (NFKB1)
   05202 Transcriptional misregulation in cancer
    103677947 (NFKB1)
   05206 MicroRNAs in cancer
    103677947 (NFKB1)
   05203 Viral carcinogenesis
    103677947 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103677947 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103677947 (NFKB1)
   05221 Acute myeloid leukemia
    103677947 (NFKB1)
   05220 Chronic myeloid leukemia
    103677947 (NFKB1)
   05215 Prostate cancer
    103677947 (NFKB1)
   05222 Small cell lung cancer
    103677947 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103677947 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103677947 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    103677947 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    103677947 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103677947 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103677947 (NFKB1)
   04931 Insulin resistance
    103677947 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103677947 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103677947 (NFKB1)
   05135 Yersinia infection
    103677947 (NFKB1)
   05133 Pertussis
    103677947 (NFKB1)
   05134 Legionellosis
    103677947 (NFKB1)
   05152 Tuberculosis
    103677947 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103677947 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    103677947 (NFKB1)
   05161 Hepatitis B
    103677947 (NFKB1)
   05160 Hepatitis C
    103677947 (NFKB1)
   05171 Coronavirus disease - COVID-19
    103677947 (NFKB1)
   05164 Influenza A
    103677947 (NFKB1)
   05162 Measles
    103677947 (NFKB1)
   05168 Herpes simplex virus 1 infection
    103677947 (NFKB1)
   05163 Human cytomegalovirus infection
    103677947 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103677947 (NFKB1)
   05169 Epstein-Barr virus infection
    103677947 (NFKB1)
   05165 Human papillomavirus infection
    103677947 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103677947 (NFKB1)
   05145 Toxoplasmosis
    103677947 (NFKB1)
   05140 Leishmaniasis
    103677947 (NFKB1)
   05142 Chagas disease
    103677947 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103677947 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103677947 (NFKB1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103677947 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 103677947
NCBI-ProteinID: XP_008705431
UniProt: A0A384DEK3
LinkDB
Position
Un
AA seq 972 aa
MAEDDTYLGGHEQMFHLDPLTHTIFNPELFQPEMALPTADGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNTHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACTKGYNPGLLVHPDLAYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGAGGTGPGYGFPHYGFPTYGGITFH
PGTTKSNAGMKHGTINTLSKNDSEGCGKSVDREAVNLSGKVTEPTERDKESSSGDDEITL
TYTVGVKEENSRFHDNLFLQKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENG
DSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEAVVDDLLR
AGADLSLLDRAGNSVLHLAAKEGQDKILSILLKHKKAAPLMDHPNGEGLNAIHLAVMSDS
MPCLLLLVAAGADVNAQERKSGRTALHLAVERDNISLAGCLLLEGDAHVDSTTYDGTTAL
HIAAGRGSTRLAALLKAAGADPLVENFEPLYELDDSWDKDGEDEGVVPGTTPLDMATNWQ
VFDILNGKPYEPEFTSDDLLAQGDMKQLTEEAKLQLYKLLEIPDPDKNWATLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTIRELVEALRQMGYTEAIEVIQAAFCTPGSVAPGPG
KAIPQTLSLPLSPASTRSPLDEVRDDSICDSGVETSFRKLSFTESLTSGSSLLTLNKVPH
EYGQEGPIEGKI
NT seq 2919 nt   +upstreamnt  +downstreamnt
atggcagaagacgatacgtatttgggagggcatgaacaaatgtttcatttggatcctttg
actcatacaatatttaatccagaattatttcaaccagaaatggcactacctacagcagat
ggtccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccgtcccatggtggactccccggtgcatctagtgaaaagaacaagaagtcc
taccctcaggtcaaaatctgcaactatgtgggacctgcaaaggtcattgtccagttggtc
acaaatgggaaaaacacccacctgcatgcacacagcctggtgggaaaacactgtgaggac
gggatctgcactgtaactgccggacccaaggacatggtggtcggctttgcaaacttgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacggatgacagaggca
tgtacgaagggctacaatcccggacttttggtgcaccctgatctggcttacttgcaagcg
gaaggcggaggagaccggcagctcacagatcgggaaaaggagatcatccgccaggcagct
cttcagcagacgaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccagacagcaccggcagcttcacgaggcgcctggagcccgtggtgtcagacgccatctac
gacagcaaagcccccaatgcgtccaacttgaaaattgtaagaatggacaggacagctgga
tgcgtaaccggaggggaagagatttatcttctctgtgacaaggttcagaaagatgacatc
cagattcgattttacgaagaggaggaaaatggtgggatctgggaaggatttggagatttt
tcccccacagatgttcatagacaattcgccatcgtcttcaaaactccaaagtataaagat
gtcaacatcacaaaaccagcttccgtgtttgtccagcttcggaggaaatctgatctggaa
accagcgaacccaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaaacggcagaagctcatgcctaatttctcagatagtttcggcggcgggagcggagct
ggagctggaggcggaggcatgtttggcagtggcggtggaggagggggtgctggaggtacg
gggccagggtatggcttccctcactacggatttcctacatatggtggaattactttccat
cctggaaccactaaatctaatgccgggatgaaacatggaaccataaacaccctatctaaa
aatgattctgaaggttgtggcaagagtgtggacagagaggcagtgaacctctctgggaaa
gtaactgaacccacagaacgagataaggagtccagctctggggatgatgagattactctg
acgtacacagtgggagtaaaggaagagaattctaggtttcacgataacctctttctccag
aaggctatgcagcttgccaagcggcatgccaacgccctttttgactacgcggtgacaggg
gatgtgaagatgctgctggctgtccaacgccacctcactgcagtgcaggatgagaatggg
gacagtgtcttacacttagcaatcatccatcttcatgcccagcttgtgagggatctactg
gaagtcacgtctggtttgatttctgatgacatcatcaatatgagaaatgatctctaccag
acgcccttgcacctggcggtgatcaccaagcaggaagctgtggtggacgacttgctgagg
gccggggccgacctgagccttctggaccgcgcgggtaactctgtgctgcacctagccgcc
aaagaaggacaagataagatcctcagtattttactcaagcacaaaaaggcagcgccactg
atggaccaccccaatggggaaggtctaaacgccattcacctagctgtgatgagcgacagc
atgccgtgtctgctgctgctggtggccgcgggcgccgacgtcaacgcccaggagcggaag
tccgggcgcacggcgctgcacctggcagtggagcgtgacaacatctccctggctggctgc
ctgctcctggagggtgatgcccatgtagacagtacgacctatgatggaactacagccctg
cacatagcagccgggagagggtccaccaggctggcggctcttctcaaggcagcaggcgca
gatcccctggtggagaactttgagcctctctatgagctggatgactcttgggacaaagat
ggagaggatgaaggagtcgtgcctggaaccacacctctagatatggccaccaactggcag
gtatttgatatattaaatgggaagccatacgagccagagtttacatctgatgatttactg
gcgcaaggagacatgaaacagctgactgaggaggcaaagctgcagctctacaagttgcta
gaaatccctgatccagacaaaaactgggctactctggcacagaaattaggtctggggata
ctaaataatgccttccggctgagtcctgctccttctaaaactcttatggacaactacgag
gtctccgggggcacgataagagagctggtggaggccctgagacaaatgggctataccgaa
gccatcgaagtgatccaggcggccttctgcaccccgggatctgtggcccccggccccggg
aaggccatacctcagaccctctcgctgcccctctcacctgcctccacgaggtcaccacta
gacgaggtccgagacgacagcatctgcgacagcggcgtggagacgtccttccgcaaactc
agctttacagagtctctgaccagtggcagctccttgctgactcttaacaaagtgccccac
gagtacgggcaggaaggacccatagagggcaaaatctag

KEGG   Ursus maritimus (polar bear): 103679584
Entry
103679584         CDS       T03271                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01523  Antifolate resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04066  HIF-1 signaling pathway
umr04071  Sphingolipid signaling pathway
umr04137  Mitophagy - animal
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04218  Cellular senescence
umr04380  Osteoclast differentiation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04917  Prolactin signaling pathway
umr04920  Adipocytokine signaling pathway
umr04926  Relaxin signaling pathway
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05030  Cocaine addiction
umr05132  Salmonella infection
umr05133  Pertussis
umr05134  Legionellosis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05212  Pancreatic cancer
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05321  Inflammatory bowel disease
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103679584 (RELA)
   04014 Ras signaling pathway
    103679584 (RELA)
   04064 NF-kappa B signaling pathway
    103679584 (RELA)
   04668 TNF signaling pathway
    103679584 (RELA)
   04066 HIF-1 signaling pathway
    103679584 (RELA)
   04071 Sphingolipid signaling pathway
    103679584 (RELA)
   04024 cAMP signaling pathway
    103679584 (RELA)
   04151 PI3K-Akt signaling pathway
    103679584 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103679584 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    103679584 (RELA)
   04218 Cellular senescence
    103679584 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103679584 (RELA)
   04620 Toll-like receptor signaling pathway
    103679584 (RELA)
   04621 NOD-like receptor signaling pathway
    103679584 (RELA)
   04622 RIG-I-like receptor signaling pathway
    103679584 (RELA)
   04623 Cytosolic DNA-sensing pathway
    103679584 (RELA)
   04625 C-type lectin receptor signaling pathway
    103679584 (RELA)
   04660 T cell receptor signaling pathway
    103679584 (RELA)
   04658 Th1 and Th2 cell differentiation
    103679584 (RELA)
   04659 Th17 cell differentiation
    103679584 (RELA)
   04657 IL-17 signaling pathway
    103679584 (RELA)
   04662 B cell receptor signaling pathway
    103679584 (RELA)
   04062 Chemokine signaling pathway
    103679584 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103679584 (RELA)
   04917 Prolactin signaling pathway
    103679584 (RELA)
   04926 Relaxin signaling pathway
    103679584 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103679584 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103679584 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    103679584 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679584 (RELA)
   05202 Transcriptional misregulation in cancer
    103679584 (RELA)
   05203 Viral carcinogenesis
    103679584 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103679584 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103679584 (RELA)
   05221 Acute myeloid leukemia
    103679584 (RELA)
   05220 Chronic myeloid leukemia
    103679584 (RELA)
   05215 Prostate cancer
    103679584 (RELA)
   05222 Small cell lung cancer
    103679584 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103679584 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103679584 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    103679584 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    103679584 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103679584 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103679584 (RELA)
   04931 Insulin resistance
    103679584 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103679584 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103679584 (RELA)
   05135 Yersinia infection
    103679584 (RELA)
   05133 Pertussis
    103679584 (RELA)
   05134 Legionellosis
    103679584 (RELA)
   05152 Tuberculosis
    103679584 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679584 (RELA)
   05170 Human immunodeficiency virus 1 infection
    103679584 (RELA)
   05161 Hepatitis B
    103679584 (RELA)
   05160 Hepatitis C
    103679584 (RELA)
   05171 Coronavirus disease - COVID-19
    103679584 (RELA)
   05164 Influenza A
    103679584 (RELA)
   05162 Measles
    103679584 (RELA)
   05168 Herpes simplex virus 1 infection
    103679584 (RELA)
   05163 Human cytomegalovirus infection
    103679584 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103679584 (RELA)
   05169 Epstein-Barr virus infection
    103679584 (RELA)
   05165 Human papillomavirus infection
    103679584 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103679584 (RELA)
   05145 Toxoplasmosis
    103679584 (RELA)
   05140 Leishmaniasis
    103679584 (RELA)
   05142 Chagas disease
    103679584 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103679584 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103679584 (RELA)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103679584 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103679584
NCBI-ProteinID: XP_008707370
UniProt: A0A384DKP9
LinkDB
Position
Un
AA seq 572 aa
MGEGAVPSFPSGSRCFCLLAPSPFPRRLQGAGPDSVPFGGRRALPGKGGERACADPCLPP
LSDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTPSVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPNQTSALAPAPAPILAQAPAPAPAPILAPGLAQAVVPPAPKTTQAGE
GTLSEALLHLQFDADEDLGALLGNSTDPAVFTDLASYPEAITRLVTGSQRPPDPAPAPLG
ASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgggagagggcgctgtacccagttttccctcaggaagcaggtgtttctgccttctcgcc
ccttctccgtttccccgcaggctccagggggcaggccctgactccgtgcccttcggaggg
cggcgggccctccctggtaaggggggggagcgggcttgtgctgacccttgtctccctccc
ctttcagacctgtttcccctcatcttcccgtctgagcccgcccaggcctctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc
cgctcagcgggcagtatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacactgggccagggacagttcgcatctccctggttaccaaggac
ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat
gaggctgagctctgccccgaccgttgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc
ttccaagttcccatcgaagaacagcgtggggactacgacctgaatgcggtgcggctgtgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct
catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac
cggaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaagtgtatttcacgggaccgggctgggaggcccgaggctccttttct
caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgatcgacaccgaattgaggag
aaacgcaaaaggacgtatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccgacctccaccccggcgcattgctgtgccttcccgaagcacaccttcc
gtccccaagccagctccccagccctatccctttacgccgtccctcagcaccatcaacttc
gaggagttctcccccatggtctttccttcggggcagatcccaaaccagacctctgccttg
gccccagcccctgccccaatcctcgcccaggccccggccccagcccctgccccgatctta
gccccaggccttgctcaggctgtggtcccccccgcccccaagaccacccaggccggggaa
gggacactgtcagaggccctgctgcacctgcagtttgacgccgacgaagacctgggggcc
ctgctgggcaacagcactgaccccgccgtgttcacagacctggcatcttaccctgaggca
ataacgcgcctggtgacagggtcccagaggccccctgacccagctcctgctcccctgggg
gcctctgggctccccaacggcctcctctcaggggatgaagacttctcctccattgcagac
atggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system