KEGG   Ursus maritimus (polar bear): 103678731
Entry
103678731         CDS       T03271                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04064  NF-kappa B signaling pathway
umr04514  Cell adhesion molecules
umr04650  Natural killer cell mediated cytotoxicity
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05143  African trypanosomiasis
umr05144  Malaria
umr05150  Staphylococcus aureus infection
umr05164  Influenza A
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05323  Rheumatoid arthritis
umr05416  Viral myocarditis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103678731 (ICAM1)
   04668 TNF signaling pathway
    103678731 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103678731 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103678731 (ICAM1)
   04670 Leukocyte transendothelial migration
    103678731 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    103678731 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103678731 (ICAM1)
   05416 Viral myocarditis
    103678731 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103678731 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    103678731 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103678731 (ICAM1)
   05164 Influenza A
    103678731 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103678731 (ICAM1)
   05169 Epstein-Barr virus infection
    103678731 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    103678731 (ICAM1)
   05143 African trypanosomiasis
    103678731 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103678731 (ICAM1)
   04090 CD molecules [BR:umr04090]
    103678731 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103678731 (ICAM1)
   04091 Lectins [BR:umr04091]
    103678731 (ICAM1)
Exosome [BR:umr04147]
 Exosomal proteins
  Proteins found in most exosomes
   103678731 (ICAM1)
CD molecules [BR:umr04090]
 Proteins
  103678731 (ICAM1)
Glycosaminoglycan binding proteins [BR:umr00536]
 Hyaluronan
  Cell surface receptors
   103678731 (ICAM1)
Lectins [BR:umr04091]
 I-type lectins (Siglecs)
  103678731 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 103678731
NCBI-ProteinID: XP_008706351
UniProt: A0A384DHA0
LinkDB
Position
Un
AA seq 575 aa
MATRRAPHNRKPWAATIKTPALSSSAVRAARLCASIARSPPSFGRLWFFARPALPALLAL
IGALLPGLGGAQTSAHPPEAIIPRGGSIQVNCSTSCDQPPILGLETQLSKKEVAHGDHWK
VFELSDVQEDSHPICFANCHTQTTAAMTLTVYWTPERVELLPLPRWQPVGENFTLRCQVA
GGAPRTSLTVVLLRGEEELSRKPAFGEPAEVTATVLAGRDDHLANFSCRTELDLRPRGLG
LFQNSSAPRQLRTFVLPETQPRLATPKIVEVGTQWTVNCSLDGLFPAVEAEVHLTLAEQE
LHCTPLYGKDSVLATASVKANAEEEGTQQLACVVTLGGQDRKWKENVILYRFPAPNLTLS
EPEVSEGTVVTVECEAQAGVVVSLSGLPSGTPAPRAQFQLNASAADHRRSFSCSAALLVA
GHLMHKNQTRELRVLYGPRLDQTDCPGNWTWEEGSQQTLRCQAWGNPVPELKCRRKGDDA
LLPIGDLRPVKREVAGTYLCQARSPRGVVTREVVVNVTYYQSNILIIILVAVAGILGTVS
TAAYLYNRQRKIQKYKLQKAQEAAAMKLNTPATPP
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggcgacgcggcgcgcgccccacaacaggaagccttgggcggccactataaaaactccc
gcgctctccagtagcgcagtccgcgccgcacgcctctgcgcttctatcgcgcgctctccg
ccctcctttggccggctatggtttttcgcccgtcccgcgctgccagcactcctggccctg
atcggagctctgctcccaggacttggaggtgcgcaaacatcagcgcaccccccagaagcc
atcataccccgaggaggctctatccaggtgaactgcagtacttcctgtgaccagcccccc
atcttgggcctggagactcagttgagtaagaaggaagtggcccatggggaccactggaag
gtctttgaactgagtgatgtgcaagaagatagccatccaatatgttttgcaaactgtcac
acacagacgacggctgcaatgaccctcaccgtgtattggaccccggagcgagtggagctg
ttacccctaccccgctggcagcccgtgggcgaaaacttcactctgcgctgccaggtggca
ggcggggcgccccggaccagcctcacggtggtgctgctccgcggggaggaggagctgagc
cgaaagccggccttcggggagcccgccgaggtcacggccacggtgctggcgggcagagac
gaccacctcgccaatttctcctgtcgcacggaactggacctgaggccccgagggctggga
ttgttccagaacagctcggcccccaggcagctccgaacctttgtcctgccagagacccag
ccacgccttgctacccccaagattgtggaagtgggcacacagtggactgtgaactgctct
ctggatgggctgttcccagctgtggaggccgaagtccacctaacactggcagaacaggaa
ctgcactgtacacccctgtacggcaaggactccgtcttggccacggccagtgtcaaggcg
aacgcagaagaggagggcacccagcagctggcgtgtgtggtgacactgggaggccaagac
cggaagtggaaggagaatgtgatactgtaccgcttccccgcacccaacctgaccctaagt
gagccagaggtctcagaagggactgtggtgactgtggagtgtgaggcccaggctggagtc
gtggtgtcgctgagcgggctcccatcggggactccagcacccagagcacaattccaacta
aatgccagcgctgcggaccacagacgcagcttctcctgctctgctgccctgctcgtggct
ggacacctgatgcacaagaaccagacccgggagctccgcgtcctgtatggtccccgacta
gaccagacggattgtccgggaaactggacatgggaggaaggctcccagcagaccctgcgg
tgccaagcttgggggaacccggttcctgagctgaaatgtcgccggaagggggatgatgct
ttgctacccatcggggacctgaggcctgtcaagcgggaggttgcgggcacttacctgtgt
caggcccggagcccccgtggtgtggtcacccgcgaagtggttgtgaatgtgacttactac
cagagcaacatactcatcatcattctggtggcagttgctggcatcctaggaactgtgagc
acagcggcttacctctataaccgccagcggaagatccagaaatacaaactacagaaggcc
caggaggcggctgccatgaagctgaacacaccggccacgcccccctga

DBGET integrated database retrieval system