KEGG   Ursus maritimus (polar bear): 103678915
Entry
103678915         CDS       T03271                                 

Gene name
XXYLT1
Definition
(RefSeq) xyloside xylosyltransferase 1
  KO
K23800  xylosyl alpha-1,3-xylosyltransferase [EC:2.4.2.62]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103678915 (XXYLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103678915 (XXYLT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.62  xylosyl alpha-1,3-xylosyltransferase
     103678915 (XXYLT1)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103678915 (XXYLT1)
SSDB
Motif
Pfam: Glyco_transf_8
Other DBs
NCBI-GeneID: 103678915
NCBI-ProteinID: XP_008706563
UniProt: A0A384DHQ3
LinkDB
Position
Un
AA seq 254 aa
MRTSAHSWGLKKCKDRHAGRLTDEANDKQVVFHDVGVLTDKLFPVVEAMQKHFSAGSGTY
YSDSIFFLSVAMHQIMPKEILRIIQLDLDLKYKTNIRELFEEFDNFLPGAIIGIAREMQP
VYRHTFWQFRHENPKTRVGGPPPEGLPGFNSGVMLRNLEAMRQSALYSRLLEPGQVRQLA
DKYRFRGHLGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFEAYFRCEGHV
KIYHGNCNTPIPDV
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagaacctcagctcacagttggggcttaaagaagtgtaaagaccgccatgctggccgt
ctcactgatgaagctaatgacaaacaggtggtcttccatgacgttggcgtgctgacggac
aagctcttcccagtggtggaggccatgcagaagcacttcagtgctggctcagggacctac
tacagtgactccatcttcttcctctctgtcgccatgcatcagattatgcccaaagagatc
ctgcggataattcagctggacctagacctgaagtacaagaccaacatccgggaattgttt
gaggagtttgacaatttcctgccaggtgccatcattggcatagcgagggaaatgcagcca
gtgtacaggcacacgttctggcagttccgccacgagaatcccaagacccgggttgggggc
cctccccccgaggggctccccggcttcaacagcggggtgatgctgcggaacctggaggcc
atgcgccagtccgccctgtacagccgcctgctggagccggggcaggtgcggcagctggcc
gacaagtaccgcttccgcggccacctgggggaccaggacttcttcaccatgatcggcatg
gagcaccccgagctcttccacgtgctggactgcacctggaaccggcagctctgcacctgg
tggagggaccacggctacagtgacgtctttgaggcttacttccggtgcgagggccacgtc
aagatctaccacgggaactgcaacacccccatcccggacgtctag

DBGET integrated database retrieval system