KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_67129Help
Entry
VOLCADRAFT_67129  CDS       T01330                                 

Gene name
hxk1
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn00051  Fructose and mannose metabolism
vcn00052  Galactose metabolism
vcn00500  Starch and sucrose metabolism
vcn00520  Amino sugar and nucleotide sugar metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
Module
vcn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vcn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_67129 (hxk1)
   00051 Fructose and mannose metabolism
    VOLCADRAFT_67129 (hxk1)
   00052 Galactose metabolism
    VOLCADRAFT_67129 (hxk1)
   00500 Starch and sucrose metabolism
    VOLCADRAFT_67129 (hxk1)
   00520 Amino sugar and nucleotide sugar metabolism
    VOLCADRAFT_67129 (hxk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    VOLCADRAFT_67129 (hxk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vcn04131]
    VOLCADRAFT_67129 (hxk1)
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     VOLCADRAFT_67129 (hxk1)
Membrane trafficking [BR:vcn04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    VOLCADRAFT_67129 (hxk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9619936
NCBI-ProteinID: XP_002956604
JGI: 67129
UniProt: D8UD50
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MRLAFALPVIGTSALAVALALRKVELPLPTEDEEKVDLLLKRYREQLLASPERLAEVEAE
FLAQMRDGLSKRVVVDGKRMMMLPTFVTRLPDGTETGECYALDLGGTNFRVMHVRLGPGK
GEVAACNVEEVTLPKEIYTGAGDKLFDYLATTLKSFIDRHSIPPSASQPQPTLPVLGFCF
SFAVEQDGLDSGRLLAWTKGFSCSGVVGNDPVALLSAALERVGRPCRVAALLNDTVGVLA
AQRYLDSDTEVGVIIGTGTNACYVERLAALTKWEPPPGAVAAAAAAAGGAGLDGRTAINM
EWGAFFSPQLPRCMEDLQVDAASPHPGKYLFEKLLSGMFLGEAARRILFTIAKEASSGNV
AVAAAAAMIPGPLATPGSLSSATLSAIVHDRSWGLRTTRRMLVSELGMHQPSARAAEVVK
EVCTLVARRSAQLTAMAVLAILRHNGWAAASPPRPVTVAIDGGVYERFTAYRTMLTEAVS
EQLGKRSSELFPLIKFVLSHDGSALGAAVLAAAAAVTATQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctagcattcgctcttcccgttattgggactagcgcattggccgtggcactggcc
ttgcggaaggttgagcttccacttcccaccgaagatgaggaaaaagttgatctgctgctc
aaacgctatagggagcaactgttggctagtccggagcggttagctgaagtggaggcagag
ttcctcgcgcaaatgcgagatgggctttcaaaacgcgttgttgtcgatggcaagcgcatg
atgatgcttccgacatttgtgacacggctgccggacggcactgagacgggtgaatgctac
gcgctggacctgggcggcaccaacttccgggtcatgcacgtccgcctgggccccggcaag
ggcgaggtggcggcctgcaatgtggaggaggtcaccctgcccaaggaaatctacaccggc
gccggcgacaagctcttcgactacctagccacgaccctcaagtccttcatcgaccgccac
agcatccccccctcagcctcgcagccacagccaacgctccccgtcctcggcttctgcttc
agtttcgcagtagagcaggacggcctggattccggcaggctcctggcttggaccaagggg
ttctcctgctcgggcgtggtgggcaacgaccccgtggcgctgctctctgcagctctggag
cgcgtgggccgcccttgccgggtggctgcgttgctgaacgacacggtgggggtgctggcg
gcgcagcgctacctggacagcgacacggaggtcggggtcattatcggcacgggcaccaac
gcctgctatgtggagagactggcggcgctgacgaagtgggagccgccgccgggagcggtt
gctgccgctgctgcagcggctggaggggcggggctagatgggcgcacggcgattaatatg
gaatggggcgcgttcttttccccgcagctgccgcggtgcatggaggacttgcaggttgat
gccgcctccccccacccggggaagtacctgttcgagaagcttctgagcggcatgtttctg
ggggaggccgcccgccgcattctgtttacaatcgccaaggaggccagcagcggcaacgtg
gcggtggcggcggcggcggccatgatcccggggccgctagcaacgcccggatcgctcagc
agcgcaacgttgtcggccattgtgcatgaccgcagctgggggctcaggaccacgaggagg
atgttggtttcggagctgggaatgcaccagcccagcgcgcgggcggctgaggtggtcaag
gaggtctgcaccttggtagctcgacgcagcgcccagctgacggcaatggcggtcctggcc
atcctgcgacacaacggctgggcggcagcgtcgccgccgcggcccgtcacggtcgccatc
gacggcggcgtgtacgaacgctttaccgcctaccgtaccatgctaacggaggctgtttcg
gagcagcttggcaagcggtcttcggagctgtttccgttgattaagttcgtactgagccac
gacggctcggcgttaggggcggcggtgctggcggcggcggcggcggtgacggcaacgcaa
tga

DBGET integrated database retrieval system