KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161254
Entry
114161254         CDS       T05908                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04020  Calcium signaling pathway
xco04260  Cardiac muscle contraction
xco04261  Adrenergic signaling in cardiomyocytes
xco04270  Vascular smooth muscle contraction
xco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114161254
   04020 Calcium signaling pathway
    114161254
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114161254
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114161254
   04261 Adrenergic signaling in cardiomyocytes
    114161254
   04270 Vascular smooth muscle contraction
    114161254
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xco04040]
    114161254
Ion channels [BR:xco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114161254
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 114161254
NCBI-ProteinID: XP_027900251
LinkDB
Position
17
AA seq 2300 aa
MVNDSKNMYIPEDTLENHQGSDYSPPPLPRPPPVGLTNEHRGGGNHGDHSGGGGGVNRGV
GVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASGGGAGLGSGGGGPISTASSTQRK
RQHYASKPKKQTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVAL
AVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFI
IVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSI
IKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCIYNHSGTNAEEKPAPCAPDGAYG
RHCMQNGTKCQVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPW
VYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWIT
QAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTRLAIRISKSKF
SRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHKQPQWLTDVQDIANKV
LLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCV
RLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDDT
RRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPEKRQDNEKPPIEEKKCEKIE
LKSITSDGETNTATKINMDDCCGDENEEKNPYPVNDYIGDEDEEEPEMPVGPRPRPLSDI
QLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKN
DSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSG
IQWIEYFLSSGGWSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVI
VTTLLQFMFACIGVQLFKGKFFYCSDSSKQTQAECRGSYIMYKDGDVGKPGKAQRIWENS
DFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIA
FFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWY
VVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFK
PRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSSSSSHPHVVRPM
GLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFF
IYAVIGMQMFGKIALRDNTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPKHPCE
KGSTNENSTTHDDCGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHH
LDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSD
GTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEV
TVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDL
NVEEEIDKGMKESVSAASEDDIFRVKRTGGLFGNHVNYYNQSDGRGSFPQSFTTQRPLHI
SQKGSPCEGESPSHEKLMDSTMFTPSSYSSSGSNANINNANNTGMTGVTTQGVSRFPSPS
ISTVDGHTGQPLTPILLPRSAWCFPPKRMFYDTLMRSDSSDSRLPIIQRGEGSTEETYDE
SYGDDRVYEDDEHSLSSDMLVYHDETCKQLTPMEEAEEVEEKKGGGGWQSPRRVFFCPTT
LARRSSFHLECLRRQTRPDVSQKTAVPLHLAHHQALAVAGLSPLLRRSHSPTLFSRLCST
PAANPTDQCSDASYQRVPSLRLEGSNSHEKLNTSLPSVNCGPWYNDSNGNSPVDSPSPTP
ASSQRAPRPVSLTVPSLLGKDPSSLSHGSAGSLVEAVLISEGLGHFAQDPSFIEATKAEL
ADACDMTIEEMEQAASNILNGNTATNPTSSTTSTSQHSPNGSLPCHNAAAAAATHRDRDA
GMSPDDAGAEAGGGRGYIHGPSSIEERQELLARGGGREEEEEEANVREARPHRSSAVVAG
ARQKNSRLLEDEDLECVTSL
NT seq 6903 nt   +upstreamnt  +downstreamnt
atggtaaatgatagcaaaaacatgtacatcccggaggacacccttgagaaccatcaaggc
tccgactactctccccctccccttcctcggcctcctccagttggcttgacgaacgagcac
agaggaggcggtaaccatggcgaccacagcggcgggggaggaggggtcaaccgtggggtg
ggtgtggttggccttgcaccggagcacattcccaccccgggagcagccctgagctggcaa
gcggccattgacgccgcgcggcaggcgaagatgatgggcaatgctgcgtcaggcggaggg
gcggggcttgggtcgggcgggggcggccccatttccacagccagctccacgcaaaggaag
agacaacactacgcttctaaacccaagaaacaaaccacaacgacagccacaaggccgccg
cgggccctgctttgtctcacactcaagaaccccatccgccgggcgtgcatcagcatcgtg
gagtggaaaccatttgagatcatcatcctgatgaccatctttgctaattgtgtggcctta
gccgtctacatccccttccctgaggatgactcgaatgccaccaactccaacctggagcgc
gtggagtacctgttccttatcatttttactgtggaggcgttcctcaaggtgatagcttac
ggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgctcgacttcatc
attgtagtagtagggttattcagtgcgattttggagcaggccacaaagggagatggggcc
actccgattggagggaaggcggcaggcttcgatgtcaaggctctgcgggcattcagagta
ctaagaccgctcagactggtctctggagtacccagtttacaagtcgtgttgaactccata
atcaaagccatggttcctctgctccacatcgccctcctggttctcttcgtcatcatcatc
tatgccatcatcggcctggagctcttcatgggcaagatgcacaagacctgcatttacaac
cattcaggtacaaatgcagaggaaaaaccagcaccatgtgcacctgacggcgcttacggt
cggcactgcatgcagaacggaacgaagtgccaagtgggttgggaaggcccaaatgatgga
atcaccaactttgacaactttgcctttgccatgctgacagtgttccagtgcataacgatg
gaaggctggacggacgtgttgtactggatgcaggatgctatgggctatgagctgccatgg
gtctattttgtctctcttgtcatctttggctcatttttcgttctcaacctcgttctgggt
gtgttgagcggagagttttccaaggaaagagagaaggccaaagcacgtggcgacttccag
aaactacgagaaaaacagcaactggaggaggaccttaagggctatttagactggatcact
caggctgaagacatcgacccagagaatgaagaggagggcttggacgatgacaaacccaga
aacctgagcatgccagccagtgaaaacgaatcagtcaacacagataacgctcccggggga
gatgtggagggggagacctgctgcaccagactggcaattaggatctccaaatccaagttc
agtcgctactctcggaggtggaacaggttgtgtaggcgaaagtgtcgagcagcagtcaag
tcccaggttttctattggctggtcatcttcctggtttttctcaacaccctgaccatcgcc
tctgaacatcacaagcagcctcagtggctaacagacgtgcaagatatagcaaataaagta
ttactagcgctcttcactggtgagatgctcctaaagatgtacagtcttggtctacaggcg
tacttcgtgtcgctcttcaacaggttcgacagcttcgtcgtgtgtggaggaatactagag
accattctagttgaaacaaagatcatgtctcctcttggcatctcagtgttacgttgcgta
cgcctgttgagaatatttaaaataacaagatactggaactctctctccaacctcgtggcc
tccctactcaactccgttcgttccattgcctccctgctactcctgctcttcctcttcatt
atcatcttctccctgctgggcatgcagctctttggggggaaattcaactttgacgacacc
agacggagcacctttgacaactttccccagtctctgctcactgtgttccagattctaaca
ggagaagactggaactctgttatgtatgatggcatcatggcgtacggaggcccgtctttt
cctggcatgctggtctgcatctactttatcatcctcttcatctgcggaaactacatccta
ctgaatgtcttcttggccatcgctgtcgacaatctagcagatgctgagagtctgacatcg
gctcagaaagaagaggaggaggcgaaggagaggaaaaaactggccaggcttgccagtcca
gagaagcgtcaggataacgagaagcccccgatagaggaaaagaagtgtgagaagattgaa
ctgaagtccatcacttctgatggagaaaccaacactgcaactaagatcaacatggatgac
tgctgtggagatgaaaatgaagagaagaacccatatcctgtgaatgattacataggagat
gaggatgaggaggagccagagatgccagtgggcccgaggccgcggccgctctctgacatt
cagctgaaagagaaggccgttcccatgcccgaggcccgcgccttcttcatcttcagccac
accaacaaattcagggttctgtgccacaagattgtcaaccacaacatcttcaccaatctc
atcctattcttcatcctgctcagcagcatcagtctggcggcagaggatccagtcaagaac
gactctttcagaaatcagatcttgggctatgcagatcacgtcttcactggactcttcacc
attgagatcattcttaagatgacagcctatggagccttcctccataaaggttcattctgt
agaaattatttcaacattctggacttagtagtggtcagcgtttctctcatctcttctgga
atacaatggatagagtacttcttatcttcaggtggttggtccagtgcaattaatgttgta
aagatcctgagagtcctgcgagtgctgagaccgctgagagccatcaacagagccaaagga
ctaaagcatgtcgtgcagtgtgtttttgtggccatcagaaccatcggcaacatcgtcatc
gtcactacattgctccagtttatgtttgcctgtattggagtgcaattattcaagggaaag
ttcttctactgtagtgacagctccaaacagactcaggcagagtgcagaggttcctacatc
atgtataaggatggggatgtggggaaaccaggaaaagcccagcgaatctgggaaaacagc
gacttcaactttgatgatgtcctgcagggaatgatggctttgtttgccgtgtctacgttt
gagggctggcccgggttgctctaccgagccatagactctcacgctgaagatgtcggtcca
atctacaactaccgcgtggtcatttcgatcttcttcatcatctacatcattatcatcgcc
tttttcatgatgaacattttcgtcggtttcgtcatcgtcacatttcaggagcaaggagag
caggagtataagaactgtgagctggacaagaaccagcgtcagtgtgtggaatacgccctg
aaggctcgacctctgcgtcgctacatccccaagaacccttaccagtacaaggtgtggtat
gtggtcaactctacctacttcgagtacctgatgttcactctcatcctcctcaacaccatc
tgtctggccatgcagcaccatggacagaccaaaaatttcaatgatgcaatgaacatcctc
aacatgctcttcacaggactgttcacagtagagatgatcctaaaattaatcgccttcaag
cccagggggtactttagtgatccctggaatgtgtttgatttcctcatcgtaattggcagc
ataatagacgtcattctcagtgagatcaacccagctgactcgtcctcgtcctcctcctcc
tcctcttcgtcctcctcttcctcttcttcctcctctcacccccatgtggtaaggccaatg
ggacttcagaattctgaagagaacgccaggatctccatcaccttcttccggctgttccgc
gtgatgaggctggtgaagctgctatctcgcggggaagggattcggaccctgctgtggacc
ttcatcaaatctttccaagctctgccttatgtagctctgctaatagtgatgctcttcttc
atatacgccgtcatcggtatgcagatgtttggtaagatagcgctgcgggacaacacgcaa
atcaacaggaacaacaatttccagacgttccctcaggcagtgctgctgctcttcagatgt
gcaactggtgaggcgtggcaagaaattatgctggcgtgttctcccaaacacccatgcgag
aaagggtcaaccaatgaaaacagcacaacccatgacgattgtggcagccagtttgccatc
atttactttgtcagcttctacatgctgtgtgcctttctgatcatcaacctttttgtggcc
gtaataatggacaactttgactatctgacacgtgactggtcaattttggggcctcatcat
cttgatgagtttaagagaatctgggccgaatacgacccagaggctaaggggaggataaaa
caccttgacgtggtcaccttgctccggagaattcagcctcccctcggttttggaaagctc
tgtccacaccgggtggcatgcaagcgcctggtatcgatgaatatgcctctgaacagcgat
ggaacagttatgttcaatgccacactgtttgctttggtcagaactgcactcaggatcaag
acagaaggtaatctggagcaggctaatgaggagctaagagcaattgtgaaaaagatctgg
aagagaactagcatgaagctgttggatcaagtagtgccccctgctggtgatgatgaagta
acagttggaaagttctacgccaccttcctcattcaagaatatttccgcaagtttaagaag
agaaaagaacaaggcctggtggccaaggtgcctccaaaaactgccctttctctgcaggcg
ggcctgcggacgcttcatgacatcggtccagagatcagaagggccatctctggagacttg
aacgtggaggaggagatagataaaggcatgaaggaatccgtgtcagctgcatctgaggat
gatatcttcagggtaaagcgaacaggtggcttgtttggaaaccacgtcaactactacaac
cagagtgacggccgtgggtcctttccgcagtccttcaccactcaacgtcccttgcacata
agtcagaaaggctctccgtgcgaaggggaaagcccatcacatgagaagcttatggactcg
accatgttcaccccttcgtcatactcctcatcaggttcaaacgccaacatcaacaacgcc
aataacactggaatgactggagtgacgacccagggcgtcagtcgattcccaagtccgtcc
ataagcacggtggatgggcacacaggccagcccctcacacccatcctactacctagatca
gcatggtgtttccctccaaaaaggatgttttatgacaccctcatgcgctcggactcgagt
gacagtcgtctgccaatcatccagagaggggaggggtcaacagaggagacgtacgatgag
agttatggtgacgacagggtgtacgaggacgatgagcactcactttcttctgacatgttg
gtgtatcatgatgaaacatgtaaacagctcactcctatggaggaagcagaagaagtagag
gagaaaaaaggaggaggaggttggcagtctccacgaagagtcttcttctgtccaactacc
ctggcacggagatcttccttccatctggagtgtctccggaggcagacaaggccagatgtc
tcgcagaagactgctgtacctttacatcttgcacatcaccaggctcttgcagtggcaggt
ttgagtccccttttgagaaggagtcactcacctaccctcttcagccgactgtgttccacg
cctgcagctaaccccacagaccaatgcagtgatgcctcctaccagcgagttccttctcta
agactagagggctccaactctcatgaaaagctcaataccagcctgccttctgtaaattgt
gggccctggtacaacgacagtaatgggaatagcccagtggacagtcctagccctacgccg
gcgtccagtcaaagggcaccgcggccagtgtcactcactgtaccatcgcttttggggaag
gaccccagctcgctgtctcatggcagtgcaggcagtctagtggaagcggttcttatatca
gaaggtttgggtcattttgcccaggacccttctttcattgaggcaaccaaagccgagtta
gctgatgcctgtgacatgaccattgaggagatggagcaggcagccagcaacattctcaac
ggcaacaccgccacaaaccccacatcaagcaccacttccacctctcagcacagccccaac
ggcagcctcccctgccacaatgcagcggcagcagctgcaacgcacagggaccgagacgcc
ggcatgagtcccgacgatgcgggggcagaggctggagggggcaggggctacatccacggt
ccatcctctatagaggagcgacaggaactgctagctagagggggagggcgagaagaggag
gaagaagaggcaaatgtgagggaagcgaggccccacagaagttcagctgtggtcgcagga
gcacggcagaagaacagcaggcttttggaggatgaggatttggagtgtgtgacgagcttg
tag

DBGET integrated database retrieval system