Xenopus laevis (African clawed frog): 446851 Help Entry 446851            CDS       T01010                                  Symbol myl9.L, myl9 Name (RefSeq) myosin light chain 9 L homeolog   KO K12755   myosin regulatory light chain 9 Organism xla  Xenopus laevis (African clawed frog) Pathway xla04270   Vascular smooth muscle contraction xla04510   Focal adhesion xla04520   Adherens junction xla04530   Tight junction xla04810   Regulation of actin cytoskeleton xla04814   Motor proteins xla04820   Cytoskeleton in muscle cells xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     446851 (myl9.L)    04520 Adherens junction     446851 (myl9.L)    04530 Tight junction     446851 (myl9.L)   09142 Cell motility    04814 Motor proteins     446851 (myl9.L)    04820 Cytoskeleton in muscle cells     446851 (myl9.L)    04810 Regulation of actin cytoskeleton     446851 (myl9.L)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     446851 (myl9.L)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     446851 (myl9.L)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:xla04812]     446851 (myl9.L)    04147 Exosome [BR:xla04147]     446851 (myl9.L) Cytoskeleton proteins [BR:xla04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      446851 (myl9.L) Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of hepatic cells    446851 (myl9.L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_5 UPF0154 EF-hand_11 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  446851 NCBI-ProteinID:  NP_001087016 Xenbase:  XB-GENE-5949901 UniProt:  Q6DCU1 LinkDB All DBs Position 9_10L:38713713..38722913 Genome browser AA seq 172 aa AA seqDB search MSSKKTKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS MGKNPTDEYLDGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFINE DHLRELLTTMGDRFTDEEVDEMFREAPIDKKGNFNYVEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagaagacaaaagccaagactaccaagaagcgtccacagagggcgacttcc aatgtattcgctatgtttgaccagtcccaaatacaggagtttaaggaagccttcaacatg attgaccagaatcgagacggctttattgacaaggaagatctgcacgacatgctggcctct atgggtaaaaaccccactgatgaatatttggatggaatgatgagcgaggccccaggaccc atcaacttcactatgttcctgacaatgtttggagagaaactgaatggcacagaccctgag gatgtcatcagaaatgcctttgcctgttttgatgaggaggcttcaggattcatcaatgaa gaccacttacgagagctcctcactacgatgggagaccgcttcacagatgaggaggtggat gagatgttcagagaggccccaattgacaagaaaggcaacttcaactacgtggaattcacc cgcatcctgaaacatggagccaaggataaagacgactag

DBGET integrated database retrieval system