KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1352
Entry
XOO1352           CDS       T00235                                 

Gene name
GpmB
Definition
(GenBank) Fructose-2,6-bisphosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00860  Porphyrin and chlorophyll metabolism
xoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XOO1352 (GpmB)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     XOO1352 (GpmB)
SSDB
Motif
Pfam: His_Phos_1 Gag_p24
Other DBs
NCBI-ProteinID: AAW74606
UniProt: Q5H365
LinkDB
Position
1376094..1376684
AA seq 196 aa
MRAQITLLRHGDTGQRSYRGQLDDPLTELGWQQLRAATADGVWDAVVASTLQRCALFATE
LTQARAIPLQLDPRLREYHFGRWQGVPVADIDRDEGDALGRFWADPVGHPPPQAEPFADF
CARLSAALDDIVARSPAQRVLVVTHGGAIRALRCMVEARSFGSMTALAVPHASLHPLAWP
PAAANPAALPAVSSAG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgagagcacagatcaccttgttgcggcatggcgacaccgggcaacgcagctatcgcggt
cagctcgacgatccacttaccgagctgggctggcagcaattacgtgccgccactgccgat
ggcgtatgggacgcagtcgtggcgtccacgctgcaacgctgcgccctgttcgcaaccgaa
ttgacgcaggcgcgcgccatcccgctgcagctggacccgcgcctgcgtgaatatcacttt
ggccgctggcagggcgtgcccgtggccgatatcgaccgtgacgaaggcgacgcgctcggt
cgcttctgggccgacccggtaggccatccgccgccgcaagccgaaccgttcgctgatttc
tgcgcgcgcttgtctgcggcgctcgacgacatcgtggcgcgctctccggcgcaacgcgtg
ctggtggtcacccacggcggcgccatccgcgcgctgcgctgcatggtcgaagcgcgttcc
ttcggcagcatgaccgcgcttgctgtgccgcatgcctcgctgcatccgctggcgtggccg
ccggccgcagcgaacccggcagcactgcctgcggtctccagcgccggatga

DBGET integrated database retrieval system