KEGG   Xenopus tropicalis (western clawed frog): 100488055
Entry
100488055         CDS       T01011                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X2
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04020  Calcium signaling pathway
xtr04260  Cardiac muscle contraction
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100488055 (cacna1c)
   04020 Calcium signaling pathway
    100488055 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100488055 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100488055 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    100488055 (cacna1c)
   04270 Vascular smooth muscle contraction
    100488055 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xtr04040]
    100488055 (cacna1c)
Ion channels [BR:xtr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100488055 (cacna1c)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 100488055
NCBI-ProteinID: XP_004912541
Xenbase: XB-GENE-991126
LinkDB
Position
3
AA seq 2176 aa
MFHNLIRQANATYRPMPRDMAPRPSVVAKGQMVSETELDYVHIPPGGSNYTNPLPALGTM
NSTPGLATEHIASPGAALSWQAAIDAARQAKLMGAAANATISTVSSTQRKRQQYSKQKKQ
GTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDS
NATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAIL
EQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIA
LLVLFVIIIYAIIGLELFMGKMHKTCYYLTNGYPDVLTEEEPSPCALESNNGRHCPNGTL
CRSGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIF
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EDEDIDEEKPRNMSMPTSETESVNTDNVGSGDVEEESCGVRLAHRISKSKFSRYWRRWNR
FCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEM
LLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKIT
RYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDN
FPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI
AVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELK
AITADGESPPNTKISVEEFSTNENEEKTPYPSSNETPGEEEEEEPEMPVGPRPRPLSELH
IKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHN
SFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGI
QSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACI
GVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMM
ALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVI
VTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMF
VLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVF
DFLIVIGSVVDVILSETNHYFCDAWNTFDALIVVGSIVDIAITELNPGEHAQCSSSMNVE
ENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIG
MQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETS
EEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAE
YDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLF
ALVRTSLCIKTDGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFL
IQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAM
KEAVSAASEDDIFRRAGGLFGNHVGYYQSEVRSAFPQTFTTQRPLHINKTSGGPGDLDSP
SHEKLVDSTFTPSSYSSSGSNANINNANNTALVRLPCYRSTVSTVEGQSRPVTSRGSWKL
GSKSSVSRDSRLPIICREEASQDETYDASEEVEYSSEPSLLCSEMFSDRDEESRQLTPSE
GEVERGLCPSPKKGFLRSASLGRRASFHLECLRRYRHQGAEMSSPKAVLPQLHLVHHQAL
AVAGLSPLLRRSHSPTAFSRLCSTPPATPCPRGGWMQQTVPTLRLHGEPGSRENLNSSFP
SIHCSDCSIGRNRPSSLTVPCHPREQGRQHHGSASSLVEAVLISEGLAQFAQDPRFLQVA
THELADACDMTIEEMETAADSFLNGKASPNGKLSPFSHRRDQGLDCAGGGSEETGLSPEC
QDSDEPEDCQVYVSSL
NT seq 6531 nt   +upstreamnt  +downstreamnt
atgttccataacctcatccgccaagccaatgctacctaccggccaatgcctagagacatg
gcaccccgacccagcgtggtcgctaaaggccaaatggtttcagagacggaacttgactac
gtccacatcccacctggaggttctaactacaccaacccactgccggcgctgggcaccatg
aactcgacccctggcctggcaacggagcacatcgcctctccgggcgctgctctgtcctgg
caagccgccatcgatgcagcacgccaggccaagcttatgggcgcggcggctaacgccacc
atatctacggtgagctccacacagaggaagaggcagcagtacagcaagcaaaaaaagcaa
gggaccaccacagccacaaggccgccccgggcgttgctctgtttgaccctgaaaaacccc
atccgacgagcctgcatcagtattgtggaatggaaaccgtttgaaattattattttactg
actatctttgccaactgtgtggccttagctgtctacatccctttcccagaggatgattcc
aacgcgactaactccaatctggaacgggtagaatatctcttcctcatcattttcacagtg
gaagccttcttaaaagtcattgcatacgggcttctgttccaccccaacgcttacctccgc
aacggctggaatctgctggatttcattattgtagtagtagggcttttcagtgcaatttta
gagcaggccacaaaggcagacgggggcagcgccattggagggaaaggagccggatttgac
gtgaaagcacttcgggcgttcagagtcttgagacccctaaggctggtgtctggagtcccc
agcctccaggtggtgctgaattccattataaaggctatggttccactgctgcatatcgct
ctgctggtgctgtttgtcattattatctatgctataattgggttggagctgttcatgggc
aaaatgcacaagacctgctactacctgacaaatggatatccagatgttctcacagaggaa
gaaccctcaccgtgtgcattggagagcaataatgggcggcactgtcccaacggcactttg
tgcagatctggttgggtgggacccaaacacggcatcactaatttcgacaactttgcattt
gccatgctcactgtcttccaatgcatcaccatggagggctggacagatgtgctctactgg
atgcaggacgccatgggatacgaactgccctgtgtctactttgtcagtctcgtcatcttt
ggatcattctttgttctgaacctggttcttggtgtcctgagtggtgagttttccaaagag
agagagaaggccaaggctcggggcgacttccagaagcttagagagaagcagcagctggag
gaggacctgaaaggctatttggactggatcactcaggctgaggacatcgacccagagaat
gaagatgaagatattgacgaagagaaacctcggaatatgagcatgccaaccagcgagacg
gagtcggtcaacacagacaacgtgggcagtggcgacgtggaagaagagagctgcggagta
cgccttgcgcacaggatttccaagtctaaatttagtcggtactggcggagatggaaccgg
ttttgcagaaggaagtgtagggcggctgtaaaatcaaacgtcttttattggctggttata
tttcttgtgtttctgaacactctgaccatcgcttctgagcactataaccaacccgattgg
cttaccgaggtacaagacacagccaacaaagtgctcctggctctcttcacagcagagatg
cttctcaaaatgtacagccttggcctgcaagcctactttgtttccctgtttaatcggttt
gactgcttcattgtgtgtggtgggatcttggagaccatattagtcgagactaggatcatg
tcacccttgggaatctccgtgctgcgctgtgtgcgccttctcaggatattcaagattacc
aggtactggaactctctgagtaatcttgtggcctcgctgctgaattccgtgcgctccatc
gcttcccttctcctccttctcttcctcttcatcatcatcttttcccttctggggatgcaa
ctctttggcggcaaatttaactttgacgagatgctgacccgcaggagcacgttcgataac
ttcccacaggctttgcttactgtctttcagatccttaccggagaggactggaactcagta
atgtatgatggaatcatggcatatgggggaccctcctttcctgggatgcttgtgtgcatt
tatttcatcatactcttcatctgtggaaattatatacttctgaatgtcttcttggccatt
gctgtggacaacttggccgatgctgagagtcttacctctgctcagaaagaggaagaagaa
gagaaggagaggaagaaactagcaagaactgctagccctgagaagaaacaggagaatgag
tccctagggaagtctccagtgccagccgtggaggagaacaaagagaagatagagttgaag
gccatcacggcagacggggagtctccacccaacaccaagatcagcgtggaagagttttcg
accaatgagaatgaggagaagaccccctatcccagctccaatgaaaccccaggtgaggag
gaagaagaagagcctgagatgcctgttggccctcgcccaaggcctctgtcggagttgcac
atcaaggagaaagctgccccaatgcctgaagcctctgcctttttcgtattccgctcagat
aacaggttccgcgtccactgccaccgaatagtcaacaataacatcttcaccaaccttatc
cttttcttcattctcttgagcagcatttccctggcagcggaagacccagtgcgacacaac
tccttcaggaaccaagttctgttttatttcgatatagttttcactgccattttcaccgta
gagatagtcctgaagatgacggcctatggggctttcttgcacaaaggctccttttgcagg
aactacttcaacatcctggatcttctggtggtcagtgtctccctcatctcctttggaatc
caatccagcgccatcaacgtagtcaagatcttacgagtacttagggtgctgaggcccctg
agagccatcaaccgagccaaggggctaaagcacgtggtacagtgtgtgtttgtggctatc
cgcaccattggcaacatcgtcattgtcaccactctgctgcaatttatgtttgcttgtatc
ggggtgcaacttttcaagggtaaattgtacagctgcaccgacagctccaagattacagag
gcagagtgcaaagggaagtacatcacctataaggatggggatgtctcacagcccatgata
gtggatcggagctgggagaacagcaagtttgacttcgataatgttctttcggcaatgatg
gccctcttcactgtctccacatttgaggggtggccggagctgctctatcgtgccattgac
tcccacacagaagacgtgggtcccatctacaaccaccgcgtggagatctccatcttcttc
atcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggttttgtcatt
gtcacgtttcaggagcagggggagcaggagtacaagaactgcgagctggacaagaaccag
cgtcagtgtgtggagtacgccctgaaagcacgtcctctgaggagatacatacccaaaaat
cagtaccagtacaaagtctggtatgtggtcaactccacctatttcgagtacctcatgttc
gtgctcattttactcaacaccatctgtctcgccatgcagcactacgggcagagctgttct
ttcaaggaagccatgaacatcctcaacatgttgttcacgggactcttcacggttgagatg
atcctgaagctcattgcctttaagccaaagggttattttagtgacccttggaatgtcttt
gactttctcatcgttattggcagcgtagttgacgtcattctcagcgagaccaatcactat
ttctgtgatgcatggaacacatttgatgcactgatagtagtgggtagcattgttgatata
gcaatcaccgaactcaacccaggtgaacatgcccaatgctcctcctctatgaacgtcgag
gagaattcccgcatctccatcaccttcttcaggctcttccgagtcatgaggcttgtgaag
cttctcagccgcggagaagggatccggactctgctatggactttcatcaagtctttccag
gctctcccctatgtagcgctgctcattgtcatgctgttctttatctacgccgtcattggc
atgcaggtttttgggaaaattgcactgaatgacaccaccgaaatcaacaggaacaataat
tttcagactttccctcaggcagttctgctcctcttcagatgtgccacaggtgaagcctgg
caggagataatgctcgcctgtctccccagtaagccctgtgcccccgaatccgaaaccagc
gaagaaaagtgcggcagcagctttgccgtcttctattttatcagcttctacatgctctgc
gccttcttgatcattaatctgtttgttgctgtcatcatggataattttgactatctgaca
cgggattggtccatattgggccctcatcatttggatgaatttaaacggatttgggcagag
tatgatccagaagccaaggggcgcatcaagcatctggatgttgtgaccctactaagacgg
attcagccccccctgggctttgggaagctgtgcccccatcgggtggcatgtaagcgcctt
gtggctatgaacatgccactgaatagtgatggaacagtcatgtttaatgccacgctcttt
gccttagttaggacatctctgtgcatcaagacagacgggaacctggaacaggccaatgag
gagctgagagccatcatcaaaaagatatggaagagaaccagcatgaaacttttggaccag
gtggtgcctccggctggggatgatgaggtcacggtgggaaagttctatgccaccttcctg
atccaggagtatttccgaaagttcaagaaacgcaaagagcaagggcttgtgggtaaacct
tcccagagaaatgcactgtccctgcaggccggcctacgcactctacatgacattggcccc
gagatccgcagggctatttctggagacctgacggctgaggaggagctggacaaggccatg
aaggaggctgtgtctgcagcatctgaggacgacatttttaggagggctggaggactgttt
gggaaccacgttggttattaccagagtgaagtccggagtgcgtttcctcagacgttcact
acccagcggcctctgcacatcaacaagacatcgggcgggccgggggatctggactctcct
tcccatgagaagctggtggattctacattcacccccagcagctactcttcctccggctcg
aacgccaacatcaacaacgctaacaacacggcactggtgcgcctgccctgttaccggagt
accgtgagcaccgtggagggacagagccggcccgtgacctcccgtggctcctggaaactt
ggctctaagagctcggtgtccagagacagtcgtctgccaataatctgccgggaggaggcc
tcgcaggatgagacgtatgacgccagcgaagaggtggaatatagcagtgagcccagcctg
ctgtgctctgaaatgttctccgatcgggatgaggaaagccggcagctaaccccatctgag
ggggaagtggagagggggctttgcccgtcccccaagaaaggtttcctgcgctcagcttct
ttaggaaggagagcgtcgttccatttggagtgcctgaggcggtatcggcaccagggggca
gaaatgtcgtcgcccaaagcggtattaccacagcttcaccttgtgcatcatcaggcttta
gcagtggcgggccttagcccgttactaaggcggagtcactcgcccacagccttctcacgt
ctctgttccacgccgcctgccaccccgtgcccccgaggaggctggatgcagcaaaccgtg
ccgacgttacggctgcacggagagccgggctctcgggaaaacctgaacagtagcttccct
tccatccactgcagtgactgcagcatagggcgtaaccggccctcctccctcacagtaccc
tgccacccacgggagcaaggcaggcagcaccatggcagcgccagcagtttagtagaagcg
gtgctgatctccgaagggctggcgcagtttgctcaggacccccgcttcctccaggtggcg
acacacgagctggccgacgcctgtgacatgacgatagaggagatggagactgccgctgac
agctttttgaatggcaaagccagccccaatgggaagctgtccccattctctcaccgtagg
gaccaggggctggactgcgcggggggtgggtcggaggagacaggactctcaccggaatgc
caggacagtgacgagccggaggactgccaggtgtatgtaagcagcctgtag

DBGET integrated database retrieval system