KEGG   Yersinia canariae: F0T03_08665
Entry
F0T03_08665       CDS       T06446                                 

Gene name
rlmKL
Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
yca  Yersinia canariae
Brite
KEGG Orthology (KO) [BR:yca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yca03009]
    F0T03_08665 (rlmKL)
Enzymes [BR:yca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     F0T03_08665 (rlmKL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     F0T03_08665 (rlmKL)
Ribosome biogenesis [BR:yca03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    F0T03_08665 (rlmKL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_31 Methyltransf_25 MTS Methyltransf_11 Methyltransf_15 N6_Mtase Methyltransf_24
Other DBs
NCBI-ProteinID: QHB32228
LinkDB
Position
1853100..1855220
AA seq 706 aa
MNSLFASTARGLEELLKSELEALGAHDCKIVQGGVHFQGDDRLMYQSLLWSRLASRILLP
LNEFKVYSDLDLYLGVQAIDWPSIFGVDKTFAVHFSGVNDEIRNSQYGALKVKDAIVDSF
TRKLDQRPTVAKQQPDIRVNVFLQREMASVALDLSGEGLHQRGYRDLTGQAPLKENLAAA
IIQRSGWQLGTPMVDPMCGSGTLLIEAAMMASDRAPGLHRAHWGFTAWSAFNEELWRELT
TEAQVRARRGLQETTSRFFGSDIDRRVIEMARANARRAGVSELITFNANDVSKLVNPLPE
GPVGTVISNPPYGERLDSEPALIALHNMLGRIMKTAFGGWRLSLFSASPELLSCLQLRAD
REFKAKNGPLDCVQKNYQLAANPQGAAGVQVAEDYANRLRKNVKKLDKWAKQQGIECYRL
YDADLPDYNVAVDRYGSKVVVQEYAPPKTIDAQKARQRLFDVINATLAVLNLPSNQLVLK
TRERQKGKSQYEKLAQKGEFLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK
DFLNLFAYTGTASVHAGLGGARSTTTVDMSRTYLEWAEKNLRANGLTGQQHRLIQADCLS
WLSNTDEQFDVIFIDPPTFSNSKRMETTFDVQRDHLVLMKELKRLLRRKGTIMFSNNKRG
FQMDLAGIEALGLEAKEITAQTQSEDFARNRQIHNCWLVTHSREEK
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgaactctctgtttgccagcacggcgcgtggactggaagaactgttaaaaagcgaactc
gaagcgctgggcgctcacgactgtaaaatagtacaggggggggtacattttcagggtgac
gatcggctcatgtaccaaagcctgctgtggagccgcttggcctcacgcattttgttaccg
cttaacgaatttaaagtttacagtgacttagatttatacctgggtgtgcaggccattgat
tggccatcaatttttggtgtagataaaacttttgccgtacattttagcggcgtgaatgat
gaaatccgcaacagccagtacggggcattaaaagttaaagatgccatcgtggatagcttt
actcgcaagctggatcagcgcccaacagttgctaaacagcaaccggatatccgggtgaat
gtgttcctgcaacgggaaatggccagcgtagcacttgatcttagtggtgaagggctgcat
cagcgcggctatcgtgacctgacggggcaggcgcccctgaaagaaaatctggcggcggcg
attatccaacgttccggttggcagttgggtaccccgatggtcgatccgatgtgcggctca
ggtacattgctgattgaagcggcgatgatggcctctgaccgggctccgggtctgcatcga
gcgcattggggttttacagcctggagcgcttttaacgaagagctgtggcgtgaattgacc
accgaagcgcaagtacgcgcccgccgtggtttgcaagagacaacctcccgcttctttgga
tcagatattgaccgtcgtgtcattgagatggcacgagccaatgcgcgccgtgctggtgtc
tcagaactgattacctttaatgctaatgatgtcagtaaactggttaatccattaccagaa
ggcccggtggggactgttatcagtaacccaccttacggtgagcggttggacagtgagcct
gcattgattgcgctgcataatatgcttggccgcatcatgaaaacggcattcggtggctgg
cgtttgtcactgttcagcgcatcgccagaattgctgagctgtttacagttacgtgcagat
cgcgaattcaaggccaagaatggcccgttggattgcgtgcagaaaaactatcaattagcg
gctaatccacaaggtgcggcaggtgttcaggtggcagaggattatgccaatcgcctgcgt
aaaaatgtgaaaaagctggataagtgggctaagcagcagggcattgaatgttaccgtttg
tatgacgccgatttgccagattacaacgtggcagtcgatcgttatggtagcaaggtggtc
gtgcaggagtatgcgccgcctaagacgattgatgcgcaaaaagcacgtcagcgcctgttt
gatgttattaatgccactttggctgtgttgaatttgccatccaatcagttggtgttgaaa
acacgtgaacgccagaaaggcaaaagccaatacgagaaattagctcagaaaggcgagttc
ctgctggtgagtgaatataatgccaagctatgggttaacctaacggattaccttgatact
ggtttgttcctcgaccaccgcattgctcgtcagatgctgggcaaaatgagtcagggtaaa
gatttccttaacttgtttgcttataccggaactgccagtgttcatgcggggctgggcggt
gcgcgcagcacgacgacagttgatatgtcgcgtacgtatttggaatgggctgagaaaaac
ctgcgagccaatggtttaaccggtcagcaacatcgcctaattcaagcggattgcctctct
tggctgagtaacaccgatgagcaattcgatgtgatctttattgatccgccgacgttctct
aactccaagcgaatggagaccacttttgatgttcagcgcgatcatttagtgctgatgaaa
gaacttaaacggttattgcgccgtaaggggacaattatgttctcgaacaataagcgcggt
ttccagatggatttggccggtatagaagcgttggggctggaagcgaaagaaatcacagcg
caaacgcaatctgaagactttgcccgtaatcgtcagatccacaactgttggctggtcacc
cacagccgcgaggaaaagtaa

DBGET integrated database retrieval system