KEGG   Yarrowia lipolytica: YALI0B22308gHelp
Entry
YALI0B22308g      CDS       T01033                                 

Definition
(RefSeq) YALI0B22308p
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00010  Glycolysis / Gluconeogenesis
yli00051  Fructose and mannose metabolism
yli00052  Galactose metabolism
yli00500  Starch and sucrose metabolism
yli00520  Amino sugar and nucleotide sugar metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yli_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0B22308g
   00051 Fructose and mannose metabolism
    YALI0B22308g
   00052 Galactose metabolism
    YALI0B22308g
   00500 Starch and sucrose metabolism
    YALI0B22308g
   00520 Amino sugar and nucleotide sugar metabolism
    YALI0B22308g
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YALI0B22308g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     YALI0B22308g
Membrane trafficking [BR:yli04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    YALI0B22308g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 2906865
NCBI-ProteinID: XP_501216
UniProt: F2Z672
LinkDB All DBs
Position
B:join(2934434..2934472,2934909..2936474)
Genome map
AA seq 534 aa AA seqDB search
MVHLGPRKPPSRKGSMADVPRDLLEQISQLETIFTVSPEKLRQITDHFVSELAKGLTKEG
GDIPMNPTWILGWPTGKESGCYLALDMGGTNLRVVKVTLDGDRGFDVMQSKYHMPPNIKV
GKQEELWEYIAECLGKFLADNYPEALDAHERGRDVDRTAAQSFTRDKSPPPHNQHISCSP
GFDIHKIPLGFTFSYPCSQPAVNRGVLQRWTKGFDIEGVEGEDVVPMLEAALERKNIPIS
ITALINDTTGTMVASNYHDPQIKLGNIFGTGVNAAYYEKVKDIPKLKGLIPDSIDPETPM
AVNCEYGAFDNEHKVLPRTKWDIIIDEESPRPGQQTFEKMSAGYYLGELLRLVLLDLYKD
GFVFENQGKNGQELGNGNINKSYFFDTSFLSLIEEDPWENLTDVEILFKEKLGINTTEPE
RKLIRRLAELIGTRSARISACGVAAICKKAGYKEAHAGADGSVFNKYPGFKERGAQALNE
IFEWNLPNPKDHPIKIVPAEDGSGVGAALCAALTIKRVKQGLPVGVKPGVKYDI
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggttcatcttggtccccgaaaacccccgtcccgaaagggctcaatggcagacgtcccg
cgggacctgctggagcaaatctcccagcttgaaaccatcttcaccgtttcgcccgaaaag
ctgcgtcaaatcaccgaccactttgtgtccgagctcgctaaaggcctcacaaaggagggt
ggagatatccccatgaaccccacctggattctgggatggcccaccggaaaggagagcggc
tgctatctggctctcgacatgggtggcaccaacctgcgagttgtcaaggtgactctggac
ggcgaccgaggcttcgacgtcatgcagtccaagtaccacatgccccccaacatcaaggtc
ggcaagcaagaggagctgtgggagtacattgccgaatgtctgggcaagttcttggccgac
aattatcctgaggctcttgatgcccatgagcgaggacgagatgtcgacagaaccgctgcg
cagagcttcactcgagacaagtctcctcctccccacaaccagcacatttcgtgttctcct
ggcttcgacatccacaagattcctctcggtttcaccttttcatatccctgctctcagccc
gccgtcaaccgaggtgtactgcagcgatggaccaagggtttcgacattgagggagtcgag
ggcgaggacgtggtccccatgctggaagctgccctcgaaagaaagaacattcctatttcc
atcaccgccctgatcaacgacaccaccggaactatggtggcctccaactaccacgacccc
cagatcaagctgggtaacatctttggtactggtgtcaacgccgcctactacgagaaggtc
aaggacattcccaagctcaagggtctcatccccgacagcattgatcccgagacccccatg
gccgtcaattgcgagtatggagccttcgacaatgagcacaaggttctccctagaaccaag
tgggacatcatcatcgatgaggagtctccccgacccggtcagcagaccttcgagaagatg
agtgctggctactacctgggagaattgcttcgtctggttcttctggacctgtacaaggac
gggtttgtgttcgagaaccagggcaagaacggtcaggagcttggaaacggcaacatcaac
aagtcgtatttcttcgacacctctttcctgtctctgattgaggaggatccctgggagaac
ttgactgatgtcgagattctcttcaaggagaagcttggtattaacaccactgagcccgag
cgaaagctcattcgtcgactggccgagctcattggtactcgatccgctcgaatctctgcc
tgtggtgtcgctgccatctgtaagaaggctggctacaaggaggctcacgctggagctgac
ggatccgtgttcaacaagtaccccggattcaaggagcgaggcgcccaggctctcaacgag
atttttgagtggaacctgcccaaccctaaggaccaccccatcaaaatcgttcccgctgag
gatggtagcggtgttggagctgctctgtgcgctgctctcaccatcaagcgagtcaagcag
ggtcttcccgttggtgtcaagcccggtgtcaagtacgatatttag

DBGET integrated database retrieval system