KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1443
Entry
YPN_1443          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_1443
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_1443
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABG17773
UniProt: A0A0H2YHV8
LinkDB
Position
1642519..1644021
AA seq 500 aa
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVS
DDAYKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLD
ISKDELRRNMKRYKGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLA
SIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRY
IGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGW
CTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNT
DYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKDVA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtccactcaagacgcaaaaactaaacaagctacagtcgccagtgcgacggaatatagc
gattttaatacattactgactaaagaatttaaagcgaagtctgagcaaacgatagccgca
gtagaaggtgccgttaaaacgttggctgagcaagcgctggctaattcggtcacggtgtca
gacgatgcttataaaagtattgcttccattattgcagagattgatcgcaagctatcagat
cagattaacttaattttgcaccaccaagaattccagtctctggaaagcgcatggcgtggg
ctgcactatttagtcaataacaccgagactgatgagaagttgagattacgtttcctcgac
atttctaaagatgaattacgccgtaacatgaagcgttataaaggtgttgcttgggatcaa
agcccattattcaaaaaaatctatgaagaagaatatggccaattgggtggcgaaccatac
ggttgcctggtagcagactattactttgaccatactgcacctgacgttgacttgttggct
tcaattggcaaagttgccgcttctgcccacgtgccatttattacaggtgctgcaccgtct
gtgttgcaaatggaatcttggcaagaactgtcaaacccacgtgatttgacgaagatcttc
actcagaatcttgagtatgccgcatggaactcactgcgtcagtctgaagactctcgctat
atcggcctggcgatgccacgtttcttgtcgcgtctgccttatgggattaacaccaatccg
gtagatgccttccactttgaagagacgactgatggcgcggatcacagcaaatatgtgtgg
tcaaatgcggcttatgcgatggctgttaacatcaaccgatctttcaaagagtatggctgg
tgtacgctgattcgtggtgtggaaagtggtggtgttgttgaaggcctgccatgccatacc
ttcccgacggatgacggcggtattgatatgaaatgcccaacagaaatcgctatttctgac
cgtcgtgaagcggaactggccaagaatggctttattccactggttcacagaaagaatacg
gattacgcggcattcattggcgcgcagtccctgcaaaaacctgcagaatattacgattcg
gatgcaacggcgaacgccaacctttccgctcgtctgccatacctgtttgcttgttcacgt
tttgcacattatctgaagtgcatcgtgcgtgacaaaatcggctcttttaaagagcgtgat
gagatgcaacgttggttgaatgattgggtgatgaactatgttgatggtgacccagctaac
tcttccctggaaactaaagcgcgccgtcctttagccgccgctgaagtgattgttgaagaa
gttgaaggtaaccctggttactatcaggctaaattcttcttacgccctcatttccagtta
gaaggtttgacagtatccctgcgtatggttgctaaactgccttcgctgaaagacgtagca
taa

DBGET integrated database retrieval system