KEGG   Aquifex aeolicus: aq_497Help
Entry
aq_497            CDS       T00013                                 

Gene name
gsdA
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aae  Aquifex aeolicus
Pathway
aae00030  Pentose phosphate pathway
aae00480  Glutathione metabolism
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
aae01130  Biosynthesis of antibiotics
aae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    aq_497 (gsdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    aq_497 (gsdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aae04147]
    aq_497 (gsdA)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     aq_497 (gsdA)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     aq_497 (gsdA)
Exosome [BR:aae04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   aq_497 (gsdA)
  Exosomal proteins of colorectal cancer cells
   aq_497 (gsdA)
  Exosomal proteins of bladder cancer cells
   aq_497 (gsdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 1193205
NCBI-ProteinID: NP_213347
UniProt: O66787
LinkDB All DBs
Position
complement(334072..335367)
Genome map
AA seq 431 aa AA seqDB search
MSSGDTELRKRIEFIIFGGTGDLSRNKLIPAILKLKDKIDLKKIYILGRNRKKFEEIKEK
FKDFSELFVFVEFLAEREESYKNISSILGKESLKVFYLAVPPDLFKEILENVGKYLNFPE
KRIVIEKPFGLSLKHAKDLNKIISVYFKEEEIFRIDHYLGKPQVQNILAFKFSNYVFSEV
LNKCLVEKVEVIALEEVGVEGRKAYYEKVGVIRDMLQNHMLLLSSLIVMRLPPRAEDFHF
ELKNALKRAEFESESLILGKYKSYQGKAPTFALVKLHFDDERFTGVPFVLATGKKLKKKL
TRVCIHFKNFPKEIERLLGCVPERNLLVFELYPEQEVSFRVNVISPLGFLRCTESINWRV
SLKDVLGEIPEAYESLLLDVIRGDKTLFLDAEETEILWEKTEPLLKKEKEVLTYDDRVLI
PEFAEDFISCL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggagacacagagttaagaaaaaggattgaatttataatcttcggcggaacc
ggggatctgagcagaaataaattaattcccgcaatcctgaaactgaaagacaaaatagat
ttaaagaagatttacattttaggcaggaataggaaaaagtttgaagaaataaaagaaaag
tttaaggatttttcagagttattcgtgttcgtagaattcctcgcggagagggaagagagt
tataaaaatatatcaagtattttaggaaaagaatctttaaaagttttttaccttgcggta
cctcccgacctattcaaggaaattctagaaaacgtaggaaaatacctgaactttccagaa
aaacgtattgttattgaaaaacctttcggcctcagcttaaagcacgcaaaggacttaaac
aaaataatttccgtttatttcaaagaagaagaaatcttcagaatagatcactacctcgga
aagccgcaggttcaaaatatactcgcctttaagttctcaaattacgtgttttccgaagtc
ttaaacaagtgtcttgtagagaaggtggaggtaattgcccttgaagaggtgggagtagag
ggcagaaaagcttattacgagaaagtgggagtcataagggacatgctacagaatcacatg
ttgctcctctcctctttaatcgttatgagactccctccaagggcggaggacttccacttt
gagctgaagaacgccttaaagcgtgccgagtttgagtccgagagcttgatactcggaaag
tacaaaagttatcaaggaaaagctcccacttttgcccttgtaaaactccactttgacgac
gagcgtttcaccggagtgcctttcgtactcgccacgggaaaaaagttaaagaaaaaattg
acgagggtgtgcatccactttaagaacttcccgaaggagattgaacggcttctcggctgc
gttcctgagagaaatttactcgtttttgaactctatccagagcaggaagtttcctttagg
gtaaacgttatatctccacttggctttttgaggtgtacggaaagtattaactggagagtt
tccctcaaagacgttctgggagaaattcccgaagcttacgagtccctccttctggacgtc
ataaggggagacaagacgctctttctggacgcagaggagacggagatactctgggaaaaa
acagaacctctattgaaaaaagaaaaggaagttttgacttacgatgacagagtccttatt
ccagaatttgcagaggatttcatttcctgcctttga

DBGET integrated database retrieval system