Aureococcus anophagefferens: AURANDRAFT_8889 Help Entry AURANDRAFT_8889   CDS       T04134                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aaf  Aureococcus anophagefferens Pathway aaf03420   Nucleotide excision repair aaf04120   Ubiquitin mediated proteolysis aaf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aaf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AURANDRAFT_8889    04120 Ubiquitin mediated proteolysis     AURANDRAFT_8889   09124 Replication and repair    03420 Nucleotide excision repair     AURANDRAFT_8889  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aaf04121]     AURANDRAFT_8889    03400 DNA repair and recombination proteins [BR:aaf03400]     AURANDRAFT_8889 Enzymes [BR:aaf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      AURANDRAFT_8889 Ubiquitin system [BR:aaf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    AURANDRAFT_8889   Multi subunit type E3    SCF complex     Ring finger protein      AURANDRAFT_8889    Cul2 complex      AURANDRAFT_8889    Cul3 complex      AURANDRAFT_8889    Cul4 complex      AURANDRAFT_8889    Cul7 complex      AURANDRAFT_8889    Cul8 complex      AURANDRAFT_8889    Cul9 complex      AURANDRAFT_8889 DNA repair and recombination proteins [BR:aaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       AURANDRAFT_8889     TCR (transcription coupled repair) factors      Cul4-CSA complex       AURANDRAFT_8889 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-ANAPC11 zf-C3HC4 RINGv zf-C3HC4_3 CxC4 zf-RING-like Motif Other DBs NCBI-GeneID:  20229306 NCBI-ProteinID:  XP_009036670 JGI:  Auran1_8889 UniProt:  F0Y8P7 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search DKCAICRNSLNEPSFEYEANPSPINENGLSIAFGCCGHARPPGLSFRLPSRARVTHQRSA QVFHLDCIQRWLKTRSVCPLCNKEWEFAK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gacaagtgcgccatctgccggaactcgctcaacgagccgtccttcgagtacgaggcgaac ccgtcgccgatcaacgagaacggcctgtcgatcgccttcggctgctgcggccacgcgcgt ccgccgggcctttcgttccgccttccctcgcgcgcgcgcgtgactcaccaacgctccgcg caggtcttccacctcgactgcatccagcgctggctcaagacgcggtccgtctgccccctg tgcaacaaggagtgggagttcgccaag

DBGET integrated database retrieval system