Aedes aegypti (yellow fever mosquito): 5565270 Help Entry 5565270           CDS       T01053                                  Name (RefSeq) RING-box protein 1A isoform X2   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aag  Aedes aegypti (yellow fever mosquito) Pathway aag03420   Nucleotide excision repair aag04120   Ubiquitin mediated proteolysis aag04141   Protein processing in endoplasmic reticulum aag04310   Wnt signaling pathway aag04341   Hedgehog signaling pathway - fly aag04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:aag00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     5565270    04120 Ubiquitin mediated proteolysis     5565270   09124 Replication and repair    03420 Nucleotide excision repair     5565270  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     5565270    04341 Hedgehog signaling pathway - fly     5565270    04350 TGF-beta signaling pathway     5565270  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aag04121]     5565270    03400 DNA repair and recombination proteins [BR:aag03400]     5565270 Enzymes [BR:aag01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      5565270 Ubiquitin system [BR:aag04121]  Ubiquitin ligases (E3)   UBL E3 ligases    5565270   Multi subunit type E3    SCF complex     Ring finger protein      5565270    Cul2 complex      5565270    Cul3 complex      5565270    Cul4 complex      5565270    Cul7 complex      5565270    Cul8 complex      5565270    Cul9 complex      5565270 DNA repair and recombination proteins [BR:aag03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       5565270     TCR (transcription coupled repair) factors      Cul4-CSA complex       5565270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Hydant_A_C DUF8003 Motif Other DBs NCBI-GeneID:  5565270 NCBI-ProteinID:  XP_001649597 UniProt:  Q1HQX8 Q0IFL8 LinkDB All DBs Position 1:complement(118834052..118849786) Genome browser AA seq 109 aa AA seqDB search MEIDEEEFEQPTSSSSRGERKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQAN QASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggagatcgatgaggaagagttcgagcagccaacatccagcagcagtcgcggagagcgg aagcgattcgaagtgaaaaagtggaacgccgtagctctgtgggcctgggatatcgtggtc gacaactgcgccatttgccgcaatcacattatggatctttgcatcgaatgccaggcaaat caagcatctgccactagcgaagaatgcactgtagcctggggtgtttgtaaccacgcattc catttccactgcatctcccgttggctgaaaacacgacaagtctgcccgttggataacagg gaatgggaattccaaaagtatggacactag

DBGET integrated database retrieval system