Aedes albopictus (Asian tiger mosquito): 109402582 Help Entry 109402582         CDS       T06060                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb00510   N-Glycan biosynthesis aalb00513   Various types of N-glycan biosynthesis aalb04141   Protein processing in endoplasmic reticulum Module aalb_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:aalb00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109402582    00513 Various types of N-glycan biosynthesis     109402582  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109402582 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Phage_holin_2_1 Motif Other DBs NCBI-GeneID:  109402582 NCBI-ProteinID:  XP_029725707 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MESMVRYISPVNPAVFPHLASVLLLIGTFFTAWFFVFEVSRPKLPSSGKEGVIFKELLIS LFASIFLGFGVLFLLLSVGIYV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggagtcgatggttcgctacatctcgccggtgaatccggccgtgtttccccatcttgcc agcgtgctgctgctcatcgggaccttttttacggcgtggttcttcgtatttgaggtatcc cggccgaaactgcccagcagcggaaaggaaggggttattttcaaggagctgctcatttct ttgtttgcgtcgatcttcctcggattcggagtgctattcctgctgctctccgtgggaatc tacgtgtga

DBGET integrated database retrieval system