Anopheles albimanus: 118467483 Help Entry 118467483         CDS       T08930                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism aali  Anopheles albimanus Pathway aali00510   N-Glycan biosynthesis aali00513   Various types of N-glycan biosynthesis aali04141   Protein processing in endoplasmic reticulum Module aali_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:aali00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118467483    00513 Various types of N-glycan biosynthesis     118467483  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118467483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 TctB DUF2269 Phage_holin_2_1 Motif Other DBs NCBI-GeneID:  118467483 NCBI-ProteinID:  XP_035793918 UniProt:  A0A182FCA6 LinkDB All DBs Position 3:39497213..39497961 Genome browser AA seq 80 aa AA seqDB search MDSMVRYVSPVNPAVFPHLASVLLLFGTFFTAWFFVFEVSRPKQPSKESVIFKELLISLF ASLFLGFGILFLLLSVGLYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggattcgatggttcgatacgtgtctccggtaaatccggccgtcttccctcacctggcc agtgtgctgctgctgttcggaactttcttcacggcctggttcttcgtgttcgaggtatca cgccccaagcagccatccaaggagagcgtcatcttcaaggaacttttgatcagcctgttc gcctccctgtttctgggtttcggtatcctgtttttgctcctctcggtcggcttgtacgtg taa

DBGET integrated database retrieval system