Alternaria alternata: CC77DRAFT_1049904 Help Entry CC77DRAFT_1049904 CDS       T05291                                  Name (RefSeq) putative hyperosmotic protein 21   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aalt  Alternaria alternata Pathway aalt03420   Nucleotide excision repair aalt04111   Cell cycle - yeast aalt04120   Ubiquitin mediated proteolysis aalt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aalt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CC77DRAFT_1049904    04120 Ubiquitin mediated proteolysis     CC77DRAFT_1049904   09124 Replication and repair    03420 Nucleotide excision repair     CC77DRAFT_1049904  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CC77DRAFT_1049904  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aalt04121]     CC77DRAFT_1049904    03400 DNA repair and recombination proteins [BR:aalt03400]     CC77DRAFT_1049904 Enzymes [BR:aalt01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      CC77DRAFT_1049904 Ubiquitin system [BR:aalt04121]  Ubiquitin ligases (E3)   UBL E3 ligases    CC77DRAFT_1049904   Multi subunit type E3    SCF complex     Ring finger protein      CC77DRAFT_1049904    Cul2 complex      CC77DRAFT_1049904    Cul3 complex      CC77DRAFT_1049904    Cul4 complex      CC77DRAFT_1049904    Cul7 complex      CC77DRAFT_1049904    Cul8 complex      CC77DRAFT_1049904    Cul9 complex      CC77DRAFT_1049904 DNA repair and recombination proteins [BR:aalt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       CC77DRAFT_1049904     TCR (transcription coupled repair) factors      Cul4-CSA complex       CC77DRAFT_1049904 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  29113189 NCBI-ProteinID:  XP_018386780 JGI:  1049904 UniProt:  A0A177DRI2 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MADAPPAKTKTGKASAAGEGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQ ANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcagatgcgcccccggcgaagaccaagacgggcaaggccagtgctgctggagagggc gacaagaaacggtttgaggtcaagaagtggaacgcagtcgctctctgggcttgggatatc gtcgtcgacaactgcgccatttgccgtaaccacatcatggacctctgcatcgaatgccag gccaaccaagcctctgccaccagcgaggaatgcacagtcgcctggggcatctgcaaccac gccttccacttccactgcatttcacgatggctcaagacccgccaagtgtgcccgctagac aaccgagactgggagttccagaagtatggtcgataa

DBGET integrated database retrieval system