KEGG   Arvicola amphibius (Eurasian water vole): 119809704
Entry
119809704         CDS       T08327                                 
Symbol
Rnf7
Name
(RefSeq) RING-box protein 2 isoform X1
  KO
K10611  RING-box protein 2
Organism
aamp  Arvicola amphibius (Eurasian water vole)
Pathway
aamp04120  Ubiquitin mediated proteolysis
aamp05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:aamp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    119809704 (Rnf7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    119809704 (Rnf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aamp04121]
    119809704 (Rnf7)
Ubiquitin system [BR:aamp04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   Cul5 complex
    Ring finger protein
     119809704 (Rnf7)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5
Other DBs
NCBI-GeneID: 119809704
NCBI-ProteinID: XP_038178665
LinkDB
Position
3:complement(162861072..162867821)
AA seq 113 aa
MADVEDGEEQCVLSSHSGTAGSRPGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggccgacgtggaggacggcgaggaacagtgcgtgttgtcctcgcactccgggactgca
ggctccaggccggggggcgacaagatgttctccctcaagaagtggaacgcggtagccatg
tggagctgggacgttgagtgtgacacctgcgccatctgcagggtccaggtgatggatgcc
tgccttagatgtcaagctgaaaacaaacaagaggactgtgttgtggtctggggagaatgt
aaccattcctttcacaactgctgcatgtctctgtgggtaaaacagaacaaccgctgccct
ctctgccagcaggactgggtggtccaaagaatcggcaagtga

DBGET integrated database retrieval system