Anguilla anguilla (European eel): 118216689 Help Entry 118216689         CDS       T07545                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aang  Anguilla anguilla (European eel) Pathway aang03420   Nucleotide excision repair aang04110   Cell cycle aang04114   Oocyte meiosis aang04120   Ubiquitin mediated proteolysis aang04141   Protein processing in endoplasmic reticulum aang04310   Wnt signaling pathway aang04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:aang00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118216689 (rbx1)    04120 Ubiquitin mediated proteolysis     118216689 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     118216689 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118216689 (rbx1)    04350 TGF-beta signaling pathway     118216689 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aang04121]     118216689 (rbx1)    03400 DNA repair and recombination proteins [BR:aang03400]     118216689 (rbx1) Enzymes [BR:aang01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      118216689 (rbx1) Ubiquitin system [BR:aang04121]  Ubiquitin ligases (E3)   UBL E3 ligases    118216689 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      118216689 (rbx1)    Cul2 complex      118216689 (rbx1)    Cul3 complex      118216689 (rbx1)    Cul4 complex      118216689 (rbx1)    Cul7 complex      118216689 (rbx1)    Cul8 complex      118216689 (rbx1)    Cul9 complex      118216689 (rbx1) DNA repair and recombination proteins [BR:aang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       118216689 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       118216689 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  118216689 NCBI-ProteinID:  XP_035253979 LinkDB All DBs Position 17:20002091..20004779 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcaatggatgtggacaccccaagcggtacaaacagcggagccagcaagaaa cgttttgaagtgaagaagtggaatgcagttgctctgtgggcctgggacattgttgtagac aactgcgccatttgcaggaatcacataatggatctctgtatcgagtgccaggcgaaccag gcttcggctacatctgaagagtgcaccgtggcgtggggggtgtgcaaccatgctttccac tttcattgcatctctcgttggctgaagaccaggcaggtgtgtcctctggacaacagggaa tgggagttccagaagtatggacattga

DBGET integrated database retrieval system