Anguilla anguilla (European eel): 118218515 Help Entry 118218515         CDS       T07545                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aang  Anguilla anguilla (European eel) Pathway aang03420   Nucleotide excision repair aang04110   Cell cycle aang04114   Oocyte meiosis aang04120   Ubiquitin mediated proteolysis aang04141   Protein processing in endoplasmic reticulum aang04310   Wnt signaling pathway aang04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:aang00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118218515    04120 Ubiquitin mediated proteolysis     118218515   09124 Replication and repair    03420 Nucleotide excision repair     118218515  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118218515    04350 TGF-beta signaling pathway     118218515  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aang04121]     118218515    03400 DNA repair and recombination proteins [BR:aang03400]     118218515 Enzymes [BR:aang01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      118218515 Ubiquitin system [BR:aang04121]  Ubiquitin ligases (E3)   UBL E3 ligases    118218515   Multi subunit type E3    SCF complex     Ring finger protein      118218515    Cul2 complex      118218515    Cul3 complex      118218515    Cul4 complex      118218515    Cul7 complex      118218515    Cul8 complex      118218515    Cul9 complex      118218515 DNA repair and recombination proteins [BR:aang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       118218515     TCR (transcription coupled repair) factors      Cul4-CSA complex       118218515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  118218515 NCBI-ProteinID:  XP_035257115 LinkDB All DBs Position 2:complement(65830083..65834516) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPGGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcaatggatgtggacactccgggtggcaccaatagcggagcaagcaaaaaa cgcttcgaagttaagaagtggaatgctgtggcactttgggcctgggacattgtggtggac aactgtgccatttgcaggaaccacatcatggacctttgcattgagtgtcaagccaaccag gcctcggctacctcagaggagtgcactgtagcgtggggggtttgtaaccatgctttccac tttcactgcatttcccgttggctgaagaccaggcaggtgtgtcctctggacaacagggag tgggagttccaaaaatatggacactag

DBGET integrated database retrieval system