Anopheles arabiensis: 120898375 Help Entry 120898375         CDS       T07381                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aara  Anopheles arabiensis Pathway aara03420   Nucleotide excision repair aara04120   Ubiquitin mediated proteolysis aara04141   Protein processing in endoplasmic reticulum aara04310   Wnt signaling pathway aara04341   Hedgehog signaling pathway - fly aara04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:aara00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120898375    04120 Ubiquitin mediated proteolysis     120898375   09124 Replication and repair    03420 Nucleotide excision repair     120898375  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120898375    04341 Hedgehog signaling pathway - fly     120898375    04350 TGF-beta signaling pathway     120898375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aara04121]     120898375    03400 DNA repair and recombination proteins [BR:aara03400]     120898375 Enzymes [BR:aara01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120898375 Ubiquitin system [BR:aara04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120898375   Multi subunit type E3    SCF complex     Ring finger protein      120898375    Cul2 complex      120898375    Cul3 complex      120898375    Cul4 complex      120898375    Cul7 complex      120898375    Cul8 complex      120898375    Cul9 complex      120898375 DNA repair and recombination proteins [BR:aara03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120898375     TCR (transcription coupled repair) factors      Cul4-CSA complex       120898375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Hydant_A_C Motif Other DBs NCBI-GeneID:  120898375 NCBI-ProteinID:  XP_040160102 UniProt:  A0A182HNZ4 LinkDB All DBs Position 2:75361351..75362187 Genome browser AA seq 109 aa AA seqDB search MDIDEEEFEAPTSSSSRGERKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQAN QASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggatatcgacgaggaagagttcgaggcaccgacgtccagcagcagccgaggtgagcgg aagcggttcgaggtcaagaagtggaacgcggtagccttgtgggcctgggacatcgtggtg gacaactgtgcgatctgccgaaatcacatcatggatctgtgcatcgagtgccaggcgaac caagcgtccgccaccagcgaggaatgcacggtggcttggggtgtgtgtaatcatgcgttc cacttccactgcatctcccgatggctgaagacccggcaggtctgtccgctcgacaacaga gagtgggagttccagaagtacggtcattag

DBGET integrated database retrieval system