Agaricus bisporus var. bisporus H97: AGABI2DRAFT139777 Help Entry AGABI2DRAFT139777 CDS       T03140                                  Symbol AGABI2DRAFT_139777 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism abv  Agaricus bisporus var. bisporus H97 Pathway abv03420   Nucleotide excision repair abv04111   Cell cycle - yeast abv04120   Ubiquitin mediated proteolysis abv04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:abv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AGABI2DRAFT139777 (AGABI2DRAFT_139777)    04120 Ubiquitin mediated proteolysis     AGABI2DRAFT139777 (AGABI2DRAFT_139777)   09124 Replication and repair    03420 Nucleotide excision repair     AGABI2DRAFT139777 (AGABI2DRAFT_139777)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     AGABI2DRAFT139777 (AGABI2DRAFT_139777)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:abv04121]     AGABI2DRAFT139777 (AGABI2DRAFT_139777)    03400 DNA repair and recombination proteins [BR:abv03400]     AGABI2DRAFT139777 (AGABI2DRAFT_139777) Enzymes [BR:abv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      AGABI2DRAFT139777 (AGABI2DRAFT_139777) Ubiquitin system [BR:abv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    AGABI2DRAFT139777 (AGABI2DRAFT_139777)   Multi subunit type E3    SCF complex     Ring finger protein      AGABI2DRAFT139777 (AGABI2DRAFT_139777)    Cul2 complex      AGABI2DRAFT139777 (AGABI2DRAFT_139777)    Cul3 complex      AGABI2DRAFT139777 (AGABI2DRAFT_139777)    Cul4 complex      AGABI2DRAFT139777 (AGABI2DRAFT_139777)    Cul7 complex      AGABI2DRAFT139777 (AGABI2DRAFT_139777)    Cul8 complex      AGABI2DRAFT139777 (AGABI2DRAFT_139777)    Cul9 complex      AGABI2DRAFT139777 (AGABI2DRAFT_139777) DNA repair and recombination proteins [BR:abv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       AGABI2DRAFT139777 (AGABI2DRAFT_139777)     TCR (transcription coupled repair) factors      Cul4-CSA complex       AGABI2DRAFT139777 (AGABI2DRAFT_139777) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 Motif Other DBs NCBI-GeneID:  18078756 NCBI-ProteinID:  XP_006457404 JGI:  Agabi_varbisH97_2_139777 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MADAMEVDGEPKTKSKKEGKDSGKARFEVKKWNAVSLWAWDIVVDNCAICRNHIMDLCID CQANQVSATSEECNAAWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggccgacgcaatggaagttgatggtgaaccaaagaccaaatccaagaaagaaggcaaa gacagtggcaaggcgcgctttgaagttaagaagtggaatgctgtttcgttgtgggcatgg gacatcgtcgtcgacaattgcgccatctgcaggaaccacattatggacttatgcattgat tgtcaagccaatcaggtttccgccacaagtgaagaatgtaatgcagcgtggggtatctgc aaccacgcctttcacttccactgtatctcccgatggctcaaaacgcgtaatgtatgcccc cttgacaatagagaatgggagctgcagaaatatggtcgttag

DBGET integrated database retrieval system