KEGG   Actinoalloteichus fjordicus: UA74_14825
Entry
UA74_14825        CDS       T04639                                 

Definition
(GenBank) methyltransferase family protein
  KO
K19104  isonocardicin synthase [EC:2.5.1.38]
Organism
acad  Actinoalloteichus fjordicus
Pathway
acad00261  Monobactam biosynthesis
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
Module
acad_M00736  Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    UA74_14825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:acad01008]
    UA74_14825
Enzymes [BR:acad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.38  isonocardicin synthase
     UA74_14825
Polyketide biosynthesis proteins [BR:acad01008]
 Nonribosomal peptide tailoring proteins
  Others
   UA74_14825
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_2 Methyltransf_31
Other DBs
NCBI-ProteinID: APU15021
LinkDB
Position
3383609..3384553
AA seq 314 aa
MTTLPATSLSETARRSPERAVETYVEGRPYDLFYLSSAGRRLVGRKTEAAYPGPDLGDGP
VERLKGCLVEPGMLLGIVEREQVAEDHVAVFHRPLDEAEKAALFAEAAADPLTDLYYPFA
QLGDRVREAAATEEGGWEVTEEFVAELDHAESVLRDYVPQRLAELGFLGGIAYDAACSTG
AFLSAVGRRFPDVRTVGQDLSAAMVEHARSRVDEVHCGDSIRPAIPAGSADLVVCRHLNA
FVVGTDQAHDLLAAAVSRCRDGGLIVLLGHTPILISTQWCEMAGLEVVQRSAATPSGHAL
FQCYVLRKGGSRDG
NT seq 945 nt   +upstreamnt  +downstreamnt
atgacgaccctgcctgcgacgagcctgtcggagaccgcccgccgttcgcctgaacgcgcg
gtggagacctacgtcgagggcaggccgtacgacctgttctatctgtcgtccgccggacgg
cggctggtgggccgcaagaccgaggccgcctatcccggcccggatctcggcgacggaccg
gtcgagcggctcaagggctgcctggtcgagccggggatgctgctgggcatcgtcgaacgg
gagcaggtggccgaggaccacgtcgcggtcttccatcggccgctggacgaggcggagaag
gcggcgctgttcgccgaggccgccgccgatcccctgaccgacctgtactaccccttcgcg
cagctcggcgaccgagtccgcgaggccgccgcgaccgaggagggcgggtgggaggtcacc
gaggagttcgtcgccgaactcgaccacgccgagtcggtcctgcgggactacgtgccgcag
cgactcgccgagctgggattcctcggcggcatcgcctacgacgccgcctgctcgacgggg
gcgttcctgtcggccgtcggccgccgcttccccgacgtccgcaccgtcggtcaggacctc
agcgcggcgatggtcgagcacgcccggtctcgggtggacgaggtccactgtggcgacagc
atccgccccgcgatcccggcgggcagcgcggacctggtggtgtgccgccatctcaacgcc
ttcgtcgtcggcaccgaccaggcccacgacctgttggcggcggcggtgagccgctgccga
gacggcgggctgatcgtgctgctcggccacaccccgatcctgatcagcacccagtggtgt
gagatggccggactggaggtggtgcagcgctcggcggccaccccgtccggtcatgcgctg
ttccagtgctacgtgctgcgcaagggagggagtcgggatgggtga

DBGET integrated database retrieval system