Aristolochia californica: 137956440 Help Entry 137956440         CDS       T10486                                  Name (GenBank) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism acak  Aristolochia californica Pathway acak03420   Nucleotide excision repair acak04120   Ubiquitin mediated proteolysis acak04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:acak00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137956440    04120 Ubiquitin mediated proteolysis     137956440   09124 Replication and repair    03420 Nucleotide excision repair     137956440  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acak04121]     137956440    03400 DNA repair and recombination proteins [BR:acak03400]     137956440 Enzymes [BR:acak01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      137956440 Ubiquitin system [BR:acak04121]  Ubiquitin ligases (E3)   UBL E3 ligases    137956440   Multi subunit type E3    SCF complex     Ring finger protein      137956440    Cul2 complex      137956440    Cul3 complex      137956440    Cul4 complex      137956440    Cul7 complex      137956440    Cul8 complex      137956440    Cul9 complex      137956440 DNA repair and recombination proteins [BR:acak03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       137956440     TCR (transcription coupled repair) factors      Cul4-CSA complex       137956440 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  137956440 NCBI-ProteinID:  XP_068660040 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MASLDTDVNMTPVGEGSSGAGPSSSAKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcttccttggatacagatgtgaacatgactcccgtgggcgaaggctctagcggtgct ggcccctcttcttctgcaaagaaacctaagcgctttgagatcaagaagtggaatgccgtt gctctctgggcttgggatattgtggtggacaattgtgctatttgcagaaaccacatcatg gatttatgcatcgaatgccaagctaatcaagcgagcgcaacgagcgaggagtgcactgtt gcctggggtgtatgcaaccatgcttttcattttcattgcattagccgatggctcaagact cgtcaagtgtgccctctagacaatagtgagtgggagttccagaaatacggacattag

DBGET integrated database retrieval system