Aristolochia californica: 137959059 Help Entry 137959059         CDS       T10486                                  Name (GenBank) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism acak  Aristolochia californica Pathway acak03420   Nucleotide excision repair acak04120   Ubiquitin mediated proteolysis acak04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:acak00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137959059    04120 Ubiquitin mediated proteolysis     137959059   09124 Replication and repair    03420 Nucleotide excision repair     137959059  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acak04121]     137959059    03400 DNA repair and recombination proteins [BR:acak03400]     137959059 Enzymes [BR:acak01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      137959059 Ubiquitin system [BR:acak04121]  Ubiquitin ligases (E3)   UBL E3 ligases    137959059   Multi subunit type E3    SCF complex     Ring finger protein      137959059    Cul2 complex      137959059    Cul3 complex      137959059    Cul4 complex      137959059    Cul7 complex      137959059    Cul8 complex      137959059    Cul9 complex      137959059 DNA repair and recombination proteins [BR:acak03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       137959059     TCR (transcription coupled repair) factors      Cul4-CSA complex       137959059 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  137959059 NCBI-ProteinID:  XP_068662440 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MASLDTDVNMTPVGEGSSGGGPFSSVKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcttccttggatactgatgtgaacatgactcccgttggtgaaggctctagcggtggt ggtcccttctcttctgtgaagaaacctaagcgctttgaaatcaagaagtggaacgccgtt gctctctgggcttgggatattgtggtggataattgtgctatttgcagaaaccacattatg gatctatgcatcgaatgtcaagctaatcaagcgagcgcaacgagtgaggagtgcactgtt gcctggggggtatgcaaccatgcttttcattttcattgcattagccggtggctcaagact cgtcaagtgtgccccctagacaatagcgagtgggagttccaaaaatacggacattag

DBGET integrated database retrieval system