Acanthamoeba castellanii: ACA1_192040 Help Entry ACA1_192040       CDS       T02667                                  Name (RefSeq) hypothetical protein   KO K26502   transmembrane protein 258 Organism acan  Acanthamoeba castellanii Pathway acan00510   N-Glycan biosynthesis acan00513   Various types of N-glycan biosynthesis acan04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:acan00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     ACA1_192040    00513 Various types of N-glycan biosynthesis     ACA1_192040  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     ACA1_192040 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF7027 CAAD Motif Other DBs NCBI-GeneID:  14915088 NCBI-ProteinID:  XP_004336487 UniProt:  L8GNP9 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MGPVSTSAYPTLAVVLTSVGLLFLTWFFVYELTTTNETGDKKRNLFKELFIASFASLFLG FGTLFLLLWSGVYV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgggccccgtcagcacttcggcgtacccgacgctcgccgtcgtgctcaccagcgtgggc ctgctcttcctcacttggttcttcgtgtacgagctgaccacaacgaacgaaacgggcgac aagaagaggaacctgttcaaggagctgttcatcgcctcgttcgcctccctgttcctgggc ttcggcaccctcttcctgctcctgtggagcggcgtctacgtgtag

DBGET integrated database retrieval system