Acanthamoeba castellanii: ACA1_368020 Help Entry ACA1_368020       CDS       T02667                                  Name (RefSeq) RINGbox protein 1, putative   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism acan  Acanthamoeba castellanii Pathway acan03420   Nucleotide excision repair acan04120   Ubiquitin mediated proteolysis acan04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:acan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     ACA1_368020    04120 Ubiquitin mediated proteolysis     ACA1_368020   09124 Replication and repair    03420 Nucleotide excision repair     ACA1_368020  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acan04121]     ACA1_368020    03400 DNA repair and recombination proteins [BR:acan03400]     ACA1_368020 Enzymes [BR:acan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      ACA1_368020 Ubiquitin system [BR:acan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    ACA1_368020   Multi subunit type E3    SCF complex     Ring finger protein      ACA1_368020    Cul2 complex      ACA1_368020    Cul3 complex      ACA1_368020    Cul4 complex      ACA1_368020    Cul7 complex      ACA1_368020    Cul8 complex      ACA1_368020    Cul9 complex      ACA1_368020 DNA repair and recombination proteins [BR:acan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       ACA1_368020     TCR (transcription coupled repair) factors      Cul4-CSA complex       ACA1_368020 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  14918892 NCBI-ProteinID:  XP_004340121 UniProt:  L8H181 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MSDTEDAGNEMVEETKDTKKKVVGKGAASKGAGGKKFEVKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRDWEFQK YGR NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtcggacacagaggatgcgggaaatgagatggtggaggagacgaaggacaccaagaag aaggtagtcggtaagggagccgcctccaagggcgctggtggcaagaagttcgaagttaag aaatggaacgctgtcgctctgtgggcctgggatatcgtcgtcgataactgcgccatttgc cgaaaccacattatggatctttgcatcgagtgccaagccaaccaagcctcggccacgagc gaagagtgcacagtcgcttggggtgtttgcaaccacgctttccacttccactgcatcagt cgctggctgaagacgagacaagtgtgccccctcgacaaccgcgactgggagttccagaaa tatggtcgctaa

DBGET integrated database retrieval system