Acinetobacter pittii: BDGL_001630 Help Entry BDGL_001630       CDS       T01684                                  Symbol folB Name (RefSeq) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism acc  Acinetobacter pittii Pathway acc00790   Folate biosynthesis acc01100   Metabolic pathways acc01240   Biosynthesis of cofactors Module acc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:acc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BDGL_001630 (folB) Enzymes [BR:acc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BDGL_001630 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BDGL_001630 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BDGL_001630 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF4942 ARC6 Motif Other DBs NCBI-GeneID:  11639811 NCBI-ProteinID:  YP_004995898 UniProt:  F0KHS1 LinkDB All DBs Position complement(1751818..1752198) Genome browser AA seq 126 aa AA seqDB search MDAIIIEGLKVETVIGCFNWERQIIQPLMLDLTIHNDLSRAAESDKLEDTLNYAQICELS AQAIQQAKPELIEHAANLVLQCLFETFPSIEKITITIRKPAIIAEANAVGIRLERTRNNF CARPSE NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggatgccattattattgaaggcttgaaagttgagacagtcattggctgtttcaactgg gaaagacaaatcattcaacctttaatgttggatttaaccatccataatgatttgagccga gcagcagagtctgacaagcttgaggacactctcaactatgcgcagatttgtgagttatcg gctcaagccattcaacaagctaaacctgaattaatcgagcatgcagcaaatttggtttta caatgtttgtttgaaacctttccatcaattgaaaaaattaccataaccatccgtaagcca gccatcattgcagaagcaaatgctgtaggaattcgtcttgaacgcaccagaaacaatttt tgcgctcgccctagcgagtaa

DBGET integrated database retrieval system