Achromobacter sp. B7: DVB37_15035
Help
Entry
DVB37_15035 CDS
T05703
Name
(GenBank) glucose 1-dehydrogenase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
achb
Achromobacter sp. B7
Pathway
achb00061
Fatty acid biosynthesis
achb00780
Biotin metabolism
achb01100
Metabolic pathways
achb01110
Biosynthesis of secondary metabolites
achb01212
Fatty acid metabolism
achb01240
Biosynthesis of cofactors
Module
achb_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
achb00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
DVB37_15035
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
DVB37_15035
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
DVB37_15035
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
achb01004
]
DVB37_15035
Enzymes [BR:
achb01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
DVB37_15035
Lipid biosynthesis proteins [BR:
achb01004
]
Fatty acid synthase
Component type
DVB37_15035
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
Epimerase
Methyltransf_25
SDR
AdoHcyase_NAD
CHASE2
Motif
Other DBs
NCBI-ProteinID:
AYD65080
LinkDB
All DBs
Position
complement(3365324..3366073)
Genome browser
AA seq
249 aa
AA seq
DB search
MDLQINDKVAIVTGSARGLGAATARKLAAEGARVVITDVLAEQAEATAAALRADGLQAHC
IVADITKAADVQRLVDETIATFGGVHILVNNAGFPRDKYLVKMSEQDWDLVMEVMLKGAF
LACKTVMPHFIDQGWGRVVNISSRAHFGNPTQANYSAAKAGLIGMAKALAIEEGRYGITV
NCVAPGFMETEMVQALPTYDTIKERAVQMQPIKRVGKPEDIANAVAFLVSEPASFITGEV
LHVTGGRYG
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atggatctgcagatcaacgacaaagtggccatcgtcacgggttccgcccggggcctgggc
gcggccaccgcccgcaagctggccgctgaaggcgcgcgtgtggtgatcaccgacgtcctg
gccgagcaggccgaagccaccgccgccgcgctgcgcgccgacggcttgcaggcgcattgc
atcgtggccgacatcaccaaggcggctgacgtgcagcgcctggtcgacgagaccatcgcc
acctttggcggcgtccacatcctggtgaacaacgcgggctttccgcgcgacaaatacctg
gtcaagatgagcgagcaggattgggacctggtcatggaagtcatgctgaaaggtgccttt
ttggcgtgcaagacggtcatgccgcacttcattgaccaaggctggggccgcgtcgtcaat
atcagttcgcgcgcgcatttcggtaacccgacgcaggcgaattactcggccgccaaggca
ggcctgatcggcatggccaaggcgctggccatcgaagaagggcgctatggaatcacggtg
aattgcgtggcgccgggcttcatggaaaccgagatggtgcaggcgctgcccacctacgac
accatcaaggagcgcgcggtgcagatgcagccgatcaaacgcgtgggcaagcccgaggac
attgccaacgccgtggcattcctggtgtcggagccggccagcttcatcacgggcgaggtg
ctgcacgtcacgggtggtcgctatggctga
DBGET
integrated database retrieval system