Achromobacter sp. HNDS-1: ABFG95_22055 Help Entry ABFG95_22055      CDS       T10763                                  Name (GenBank) acyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism achh  Achromobacter sp. HNDS-1 Pathway achh00470   D-Amino acid metabolism achh00552   Teichoic acid biosynthesis achh01100   Metabolic pathways achh01503   Cationic antimicrobial peptide (CAMP) resistance achh02020   Two-component system Brite KEGG Orthology (KO) [BR:achh00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     ABFG95_22055   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     ABFG95_22055  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ABFG95_22055  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     ABFG95_22055  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:achh01504]     ABFG95_22055 Enzymes [BR:achh01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      ABFG95_22055 Antimicrobial resistance genes [BR:achh01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     ABFG95_22055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XBO97539 UniProt:  A0AAU7L6L9 LinkDB All DBs Position complement(4779565..4779804) Genome browser AA seq 79 aa AA seqDB search MDIKEIETKVADLIEGIILTKVDPDTLLIDSGLVDSLAAVDVALAVERQFGCKIPPTEID VHLESVHTLATFIAERARA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacatcaaagaaatcgaaaccaaggtggccgacctcatcgaaggcatcatcctcacc aaagtcgatcccgacaccctgctgatcgattccggcctggtggactcgctggccgccgtg gacgtggcgctggcagtggaacgccagttcggctgcaagatcccgccgaccgagatcgac gtgcacctggaatcggtgcacacgctggccacgttcatcgcggagcgcgcccgcgcctga

DBGET integrated database retrieval system