KEGG   Achromobacter sp. JD417: LN047_02965
Entry
LN047_02965       CDS       T11120                                 
Name
(GenBank) D-alanine--poly(phosphoribitol) ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
achj  Achromobacter sp. JD417
Pathway
achj00470  D-Amino acid metabolism
achj00552  Teichoic acid biosynthesis
achj01100  Metabolic pathways
achj01503  Cationic antimicrobial peptide (CAMP) resistance
achj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:achj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    LN047_02965
  09107 Glycan biosynthesis and metabolism
   00552 Teichoic acid biosynthesis
    LN047_02965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LN047_02965
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LN047_02965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:achj01504]
    LN047_02965
Enzymes [BR:achj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LN047_02965
Antimicrobial resistance genes [BR:achj01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LN047_02965
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: XGB28293
LinkDB
Position
659406..660854
AA seq 482 aa
MRFDLKSFQFADEGRAPDALAVAAADRSLTWAQLRTEAHAWADAARKHGVAPDVPVAIYG
HKEAAFFVAMVGALLIGAPFVPVDTIYPPERLRRIVEIVQAAAVFDAAAGSFTAGEGAML
EERGLAYVMFTSGSTGDPKGVQIGRESVGLLGDWMLGSFGLGEAPVFMNQAPFSFDLSMY
EVFATLASGGSCVLNAREQIAAPGPWMARLAAHGITVWVSTPSFAHQQLANRDFSPATLP
TLRTFLFCGEPLPAALAKKLRQRFPDASILNTYGPTEATVATTWIEVTDAVLAAHDPLPV
GHAKPDSVLLVDEGEICIVGDHVMRGYLNRADLNAAKLYTYDDGRRAFRTGDLGLMEEGG
LLFCRGRMDDQIKLNGYRIELAEIDEALHGLPGVEASACAVLRRPDGTAVRLIGFVTGSE
AAGEQAALLAPQALSGWKERLAERLPPYMVPSELVACPALPMSNNHKIDRKKLIEIYSAI
PV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgcgtttcgatctgaagtccttccagttcgccgacgaagggcgcgcgcccgacgcgctg
gcggttgccgccgccgaccgcagcctgacgtgggcccagttgcgcaccgaggcgcacgcc
tgggccgacgccgcacgcaagcacggcgtggcacccgatgtgcccgtggcgatctacggc
cacaaggaagccgcctttttcgtcgccatggtcggcgcgctgctgatcggcgcgccgttc
gtgccggtggacaccatctatccgcctgagcgcctgcgccgcatcgtggagatcgtgcaa
gcggccgccgtgttcgacgctgcggccggcagcttcacggcgggcgagggcgccatgctg
gaagaacgcggcctggcctacgtgatgttcacctcgggcagcacgggcgaccccaagggc
gtgcagattggccgcgaaagcgtcggcctgcttggcgactggatgctcggcagctttggc
ctgggcgaggcgcccgtgttcatgaaccaggcgcccttcagtttcgacctgtccatgtac
gaggtctttgccaccctggcgtcgggcggaagctgcgtgctcaacgcgcgcgagcagatt
gccgcgcccggtccgtggatggcccggctggccgcccacggcatcacggtgtgggtgtcc
acgccgtcgttcgcgcatcagcagctggccaaccgcgacttctctccggcgacgctgccc
acgctgcgcacgttcctattctgcggcgagcccctgccggcggcgctggcgaaaaagctg
cggcagcgctttccggatgcgtccatcctgaacacctacggtccgaccgaagccacggtg
gccaccacctggatcgaagtcaccgacgccgtgctggcggcgcatgacccgctgccggtc
ggccatgccaaaccggacagcgtgctgctggtggacgagggcgagatctgcatcgtgggc
gaccacgtgatgcgcggctaccttaatcgcgccgacctgaacgcggccaagctctacacc
tacgacgacggccgccgcgcgttccgcacaggcgatctggggctgatggaagagggcggg
ctgctgttctgccgcggccgcatggacgaccagatcaagctcaacggctaccgcatcgag
ctggcggaaatcgacgaagccctgcatgggctaccgggcgtggaggctagcgcctgcgcc
gtgctgcgccgtcccgacggcacggcggtgcggctgattggtttcgtgacgggctcggaa
gcagcgggcgagcaagccgcgctgctggcgccgcaggccctgtccggctggaaggagcgg
ctggccgagcgcctgccgccctacatggtgccgtccgaactggtcgcctgcccggcgctg
cccatgtcgaacaaccacaagatcgaccgcaagaagctgatcgagatctacagcgcgatt
cccgtgtag

DBGET integrated database retrieval system