Acanthisitta chloris (rifleman): 103799165 Help Entry 103799165         CDS       T08456                                  Name (RefSeq) cystatin-like   KO K13899   cystatin-C Organism achl  Acanthisitta chloris (rifleman) Brite KEGG Orthology (KO) [BR:achl00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:achl01002]     103799165   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103799165 Peptidases and inhibitors [BR:achl01002]  Peptidase inhibitors   Family I25: cystatin family    103799165 Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103799165 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  103799165 NCBI-ProteinID:  XP_009069714 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search EGLQRALQFAITTYNRASNDMYSSRVVRVISAKRQGSIVAGVKYIMEVEIARTTCTKPAA DLQRCALHNEPQMAKHTICNFVVLNVPWLNRIELLSSKCQ NT seq 305 nt NT seq  +upstreamnt  +downstreamnt acgagggcctgcagcgggccctgcagttcgccatcactacgtacaacagggccagcaacg acatgtactccagccgggtggtgcgggtcatcagcgccaagaggcaggggagcattgtgg ccggagtcaagtacataatggaagtggagattgcccggacgacttgcacgaagccagcgg cagatctccagcgctgtgctttgcacaacgagccgcagatggctaagcacaccatttgca acttcgtagtgttgaatgttccttggctcaaccgaattgagctactgagcagtaagtgcc agtaa

DBGET integrated database retrieval system