Acanthisitta chloris (rifleman): 103808539 Help Entry 103808539         CDS       T08456                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism achl  Acanthisitta chloris (rifleman) Pathway achl03050   Proteasome achl04060   Cytokine-cytokine receptor interaction achl04217   Necroptosis achl04350   TGF-beta signaling pathway achl05164   Influenza A achl05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:achl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     103808539 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     103808539 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103808539 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103808539 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103808539 (IFNG)    05168 Herpes simplex virus 1 infection     103808539 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:achl03051]     103808539 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103808539 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:achl00536]     103808539 (IFNG) Proteasome [BR:achl03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     103808539 (IFNG) Cytokines and neuropeptides [BR:achl04052]  Cytokines   Interferons    103808539 (IFNG) Glycosaminoglycan binding proteins [BR:achl00536]  Heparan sulfate / Heparin   Cytokines    103808539 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Adaptin_N Zw10_N RHG29_45_N DUF948 HBM Peptidase_S49_N KELK Motif Other DBs NCBI-GeneID:  103808539 NCBI-ProteinID:  XP_009079575 UniProt:  A0A091NCJ7 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MTFQTYSLFVLSVILCCFGHVENRLNLHQLQNDIDKLKADFNSSHSDVADGGPIFTGRLS SWTERNEKRIILSQILSMYLKMFENTDKTKAHVRNISEELYTLKESLSDGSKKAEDLKDL TKLQMTDLKIQRKAVSELFSVLQKLGDVSSSHNRQRRQFQRRCRC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgactttccagacctacagcttgtttgttctgtctgtcatcctgtgttgttttggacat gttgaaaatagactaaatctgcatcaacttcaaaatgatatagacaaactgaaagctgac tttaactcaagtcattcagatgtagctgatggtggacctatctttacggggagactgtca agctggacagagagaaatgaaaaaaggatcatcctgagccagattctttccatgtacttg aaaatgtttgaaaacactgacaagacaaaggcccatgtcaggaacatctctgaggagctc tatacactgaaagaaagcctttctgatggctcaaagaaggcagaagatctcaaggacctg acaaagcttcagatgactgacttgaaaatccaacgcaaagctgtgagtgagctgttcagc gtcttacaaaaactgggggatgtttcaagctctcacaacaggcaaagaaggcagtttcag aggaggtgcagatgctaa

DBGET integrated database retrieval system