Arcobacter cloacae: ACLO_2355
Help
Entry
ACLO_2355 CDS
T06845
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acp] reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
aclo
Arcobacter cloacae
Pathway
aclo00061
Fatty acid biosynthesis
aclo00780
Biotin metabolism
aclo01100
Metabolic pathways
aclo01110
Biosynthesis of secondary metabolites
aclo01212
Fatty acid metabolism
aclo01240
Biosynthesis of cofactors
Module
aclo_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
aclo00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
ACLO_2355 (fabG)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
ACLO_2355 (fabG)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
ACLO_2355 (fabG)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
aclo01004
]
ACLO_2355 (fabG)
Enzymes [BR:
aclo01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
ACLO_2355 (fabG)
Lipid biosynthesis proteins [BR:
aclo01004
]
Fatty acid synthase
Component type
ACLO_2355 (fabG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
NAD_binding_10
Epimerase
SDR
2-Hacid_dh_C
TIR_2
Polysacc_synt_2
3HCDH_N
HFX_2341_N
NmrA
Motif
Other DBs
NCBI-ProteinID:
QKF90800
LinkDB
All DBs
Position
2329014..2329757
Genome browser
AA seq
247 aa
AA seq
DB search
MKFSGSNVLVTGASRGIGEQIAKTLASFGLKVWINYRSGAQAAEAIKEEIEKAGGKAAII
KADVTNEEEFTNAIKTIIDADGELSYLVNNAGITKDKLALRMSVNDFTDVINANLTSTFI
GCKEALKVMGKKRFGSVVNISSIVGEMGNPGQTNYSASKGGVNAMTKSFAKEAASRGIRY
NAVTPGFIQTDMTDELKEEVKAEYEKNIPLSRFGKPSEIADAVAFLLSDHSSYITGEILK
VNGGLYV
NT seq
744 nt
NT seq
+upstream
nt +downstream
nt
atgaaattttcaggttctaatgtattagttacaggtgcaagtagaggaatcggtgagcaa
atcgcaaaaactcttgcaagttttggactaaaagtttggataaattacagaagtggtgca
caagcagctgaagcaataaaagaagagatagaaaaagctggagggaaagctgcgataatt
aaagctgatgttactaatgaagaagagtttacaaatgcaatcaaaactatcattgatgca
gatggagaactatcatatttagtaaataatgctggaattacaaaagataaattagctcta
agaatgagtgtaaatgattttactgatgtaataaatgcaaacttaacttctacatttatt
ggttgtaaagaagcactaaaagtaatgggtaaaaaaagatttggttcagttgttaatatc
tcttcaattgttggagaaatgggaaatcctggacaaacaaattactcagcttcaaagggt
ggagtaaatgctatgacaaaatcttttgcaaaagaagcagcttcaagaggtataagatat
aacgcagtaactcctggttttattcaaacagatatgactgatgaattaaaagaggaagta
aaagctgaatatgaaaaaaatattcctctttcaagatttggtaaaccaagtgaaattgcc
gatgcagttgcatttttattaagtgatcattcatcttatatcacaggtgaaatattaaaa
gttaatggtggattatacgtttaa
DBGET
integrated database retrieval system