Aphelocoma coerulescens (scrub jay): 138104638 Help Entry 138104638         CDS       T10543                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe03050   Proteasome acoe04060   Cytokine-cytokine receptor interaction acoe04217   Necroptosis acoe04350   TGF-beta signaling pathway acoe05164   Influenza A acoe05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:acoe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     138104638 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     138104638 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138104638 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138104638 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     138104638 (IFNG)    05168 Herpes simplex virus 1 infection     138104638 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:acoe03051]     138104638 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acoe04052]     138104638 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:acoe00536]     138104638 (IFNG) Proteasome [BR:acoe03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     138104638 (IFNG) Cytokines and neuropeptides [BR:acoe04052]  Cytokines   Interferons    138104638 (IFNG) Glycosaminoglycan binding proteins [BR:acoe00536]  Heparan sulfate / Heparin   Cytokines    138104638 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Fib_alpha DUF948 Lipoprotein_20 ADIP Sec8_N ATG14 Phage_GP20 Seryl_tRNA_N TMPIT Motif Other DBs NCBI-GeneID:  138104638 NCBI-ProteinID:  XP_068859992 LinkDB All DBs Position 1A:complement(36052499..36055962) Genome browser AA seq 165 aa AA seqDB search MAFQTYSLFVLSVIMVSFGHVENRLHLLQLQNDIDKLKADFNSSHSDVADGGPIFTEKLS GWTERNEKRIILSQIISMYLKMLENTDRSKAHVRNISEELHTLKESLSDGSKKIEDLKDL TKLQMSDLKIQRKAVNELFSVLQKLGDTSSSHKRKRRQFQRLCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggctttccaaacctacagcttgtttgttctgtctgtcatcatggtttcttttggacat gttgaaaatagattgcatcttcttcaacttcaaaatgacatagacaaactgaaagctgat tttaactcgagtcattctgatgtcgctgatggtggacccatttttacagagaagctatca ggctggacagagagaaatgaaaaaaggatcatcctgagtcagattatttccatgtacttg aaaatgcttgaaaacactgacaggtcaaaggctcatgtgaggaacatatctgaggagctc catactctgaaagaaagcctttctgatggctcaaagaagatagaagatctcaaagacctg acaaaacttcagatgagtgacttgaaaattcagcgcaaggctgtgaatgagctgttcagt gtcctacaaaaactgggggatacctcaagttcccacaaaagaaaaagaaggcagtttcag aggctgtgcaaatgctaa

DBGET integrated database retrieval system