Anolis carolinensis (green anole): 100562638 Help Entry 100562638         CDS       T01608                                  Symbol cxcl12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism acs  Anolis carolinensis (green anole) Pathway acs04060   Cytokine-cytokine receptor interaction acs04672   Intestinal immune network for IgA production acs04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:acs00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100562638 (cxcl12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100562638 (cxcl12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     100562638 (cxcl12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acs04052]     100562638 (cxcl12)    00536 Glycosaminoglycan binding proteins [BR:acs00536]     100562638 (cxcl12) Cytokines and neuropeptides [BR:acs04052]  Cytokines   Chemokines    100562638 (cxcl12) Glycosaminoglycan binding proteins [BR:acs00536]  Heparan sulfate / Heparin   Chemokines    100562638 (cxcl12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100562638 NCBI-ProteinID:  XP_003225443 LinkDB All DBs Position Un Genome browser AA seq 94 aa AA seqDB search MESRRLALLALLLLALLGASQEKPISLTYRCPCRYVESSVAKSHIKHLKILTVPGCSLQI IARLKNSSKQICIDPKLKWIQEYLEKYLHKRLKM NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggagtcccgcaggctcgcgctcctcgccctcctcctgctcgcgctcctcggggccagc caggagaagcccatcagcctgacttatcgctgcccctgcagatatgttgagagcagtgtg gccaagtctcacattaagcacctgaagatcctgactgttcctggctgttcactccagatt attgcaagattgaaaaatagcagcaaacagatctgcattgatccgaagctaaagtggatt caggagtatctggagaaatatctacacaagagactcaagatgtaa

DBGET integrated database retrieval system